2O62


Conserved Protein Domain Family
DUF3598

?
pfam12204: DUF3598 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3598)
This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 230 and 398 amino acids in length. These proteins are formed entirely from B sheets which form a barrel structure similar to those seen in the lipocalin superfamily.
Statistics
?
PSSM-Id: 403430
View PSSM: pfam12204
Aligned: 53 rows
Threshold Bit Score: 158.993
Threshold Setting Gi: 302773482
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O62_B              4 SQWECFLQNLGV----WEGSFSNFSPEGTLLNDTSSRLCLEGLNNNQ-TVRLTLSRS-----------------GKDDVI 61  Nostoc pun...
WP_015202317        6 KNWQNFCENHLGk---WHGSRTRYSGQGEVKGWFEAFRLLQANSDQTeITHTNRNIYadstteeqswqfskhsnNFSDGI 82  Crinalium ...
jgi:Cyan7822_2663   6 QNWNNFIANHLSn---WHGIWTRYSPQGEITESFQSLRGFCANPEQNeITQTNRYQYadgkilektwkfdqqsnNLSDGL 82  Gloeothece...
jgi:Riv7116_5724    8 KNWQNLCNKHIRd---WHGVWTRYSPQKAVTESFRSLRSFESNQGQTeIAHTNRYMYadgttkeeswqynlhsnGLSDGL 84  Rivularia ...
jgi:Cal6303_3436    8 rNWQNLCDHHMYd---WYGIWTRYTPQKTVIESFQSLRSFKINDNQTeIYQVNRFKYanggerekawhlhkssdNLADGI 84  Calothrix ...
jgi:Cyan7822_1917   6 eNWLNLFGYCTEegttWHALTTVYSPELEVMRTYKFTRKFTSNADRSiIAHQNTYYLpdgtvnekswtiekqscNLSDGV 85  Gloeothece...
WP_015193044        6 TNWFNLFGQYVPekttWHALTTVYSIELEVIRSYKFTRTFSTNADKSiIYHHNIYYLpdnqikeqswklerqkcNQPDGV 85  Stanieria ...
Q119K0              8 QNWINLFGDLSPegiaWYGIWTRYSPKLEVITSFQGIRNLSANNNKTvITHRNNYTYadgstkeiqwlldkeiaNQPDGI 87  Trichodesm...
Q8YKF2              6 QHWERLFGHLTTedsaWYGIWTVYSPDQEIIKSSQGIRNLRANIDKTvITHINQFPMadgavqekqwkieketcNLTDGL 85  Nostoc sp....
jgi:Cal7507_1200    7 QHWEKLFGDLTLekksLYGVWTVYSPAQEIIKSSQGIRTLQANADKTvITHTNQFPSadrttlekqwqiakatcNLPDGL 86  Calothrix ...
2O62_B             62 REFRSVGGGLLFFENG-SFSEGLIQLGpFSEFGGELAFVHENRRLRLVQLFDRNGHLNGLTLIREHLAGTPVAERPLLQI 140 Nostoc pun...
WP_015202317       83 MHPITERMRFLALEQG-AAAGVYKKIEeQVAFGIELFLIYESLRYSLVIVYGKDGNLSSITLIREDKVAYPN-NYWSNEV 160 Crinalium ...
jgi:Cyan7822_2663  83 FHPDNELMRGIFFSSG-PAAWITTQLAlDSYLAVELFFKQEKLRHSVGIIYDKQGNLFRTANIREDATGFPS-QYWSTQL 160 Gloeothece...
jgi:Riv7116_5724   85 FHPARDYMRGFNFEPG-AAAWVTTQLKpESYFAVELFFIYENLRHSVGIVYDQKGNLLRTANIREDSNGFPS-KYWSTDI 162 Rivularia ...
jgi:Cal6303_3436   85 HHSDNPSMRALFFDNG-AAAWVTKILEdNSIFAVEFILKHEHLRISVYVIYDEYGSLTKTVSIREDANGLPS-QHWSNNV 162 Calothrix ...
jgi:Cyan7822_1917  86 CHPEGQKMRAIGFGNQ-TSIWVSKNIDdESNLGSEVFLKHDNWRYGLLTIY-KNGNLDRFVIIKENTQNFPD-TVAENTI 162 Gloeothece...
WP_015193044       86 FHPEAENMRAIGFGNE-TSIWISKTFShNHNFGSEVFFQQQDWRYSVIPVY-EGGNLSRIVTIKENKQHFPT-QINEEKI 162 Stanieria ...
Q119K0             88 IHSGAESMRVLSFSEEaKTSICPQ-LKiENPFGCELFFQHQNFRTSVVVIYGENGELARFTQIREHLNSYPD-QKPGANL 165 Trichodesm...
Q8YKF2             86 LHPADASKRALSLSSGgASAWVPKKLEsGSGFSVELFLKHEDGNTSIGSIYSENGNLEKILYLREHLGSYPQ-MTQGQQV 164 Nostoc sp....
jgi:Cal7507_1200   87 LHPADPSKRAFALFNYgATAWVPQKLElGRGFSVELFLKSPDGNTSIGSIYAENGDLEKILYLRESLSSFPDILPLGTEV 166 Calothrix ...
2O62_B            141 N-----DLLGEWRGQAVTIYRDLRPpDIYSTTLKiqlddagrlxqstsfgertitstaTIKGSIvlfdqdpekqvQVLLL 215 Nostoc pun...
WP_015202317      161 NllaqrNLSGNWIGKSIKMTPDLNVsAELP--------------------------------AElqet---tegnETLFF 205 Crinalium ...
jgi:Cyan7822_2663 161 EqlpqrSDSGNWQGTSVTMTRDLNIsDPIPTGGP------------------------NEFRTElhwg---wkdhQVFFL 213 Gloeothece...
jgi:Riv7116_5724  163 NqlperKISGNWQGTSLTMTPDLKVsEPSP--------------------------------TQlqls---wqghQTFFL 207 Rivularia ...
jgi:Cal6303_3436  163 DvlpkrSFSGNWQGSSISMTPDLEAsLATQ--------------------------------TQlqfi---tqnsETFFF 207 Calothrix ...
jgi:Cyan7822_1917 163 T-----NLEGKWHLERTKVQPNLEYfTETF----------------------------SHQEIDinss---vainTNFFL 206 Gloeothece...
WP_015193044      163 T-----NLSGKWQLKQIKMKPDLKTsNQEF----------------------------ASQEIQnsvf---iktnQNYFL 206 Stanieria ...
Q119K0            166 N-----NISGNWVRKKQSMTPDLQVfQEP-----------------------------EMREIElnlt---tgknQTFFL 208 Trichodesm...
Q8YKF2            165 N-----NLSGNWSGKKQSITPDLQIsAQE-----------------------------EVQDLMldpt---qgknKSFYL 207 Nostoc sp....
jgi:Cal7507_1200  167 T-----TLPGNWIGSQVSITPDLKItDAE-----------------------------VITEFVldpt---lgknKSFFL 209 Calothrix ...
2O62_B            216 PDGASATSPLKVQLRQPLFLEAGWLIQSDLRQRXIRSYNDKGEWVSLTLV 265 Nostoc punctiforme PCC 73102
WP_015202317      206 PDEISLSCPKEVKVGKPANITTTWLSKPDLLQQISVSYNNSGDFAELQFA 255 Crinalium epipsammum
jgi:Cyan7822_2663 214 PDGVSISCPDKISLGKSFVIAASWLVTSSQKQQLIVEYDESGAFCSLTLE 263 Gloeothece verrucosa PCC 7822
jgi:Riv7116_5724  208 PDGVSISCPEKVTLGTPFVLAANWLVTPSQLQQISAKYDKCGTFSALVFE 257 Rivularia sp. PCC 7116
jgi:Cal6303_3436  208 PDGISLSCPNRVSIGKEFAITTNWLVTPFQMQQMTVNYDEFGAFSFVKLE 257 Calothrix sp. PCC 6303
jgi:Cyan7822_1917 207 PEKVLINLPKVVPIDQAFEITVGQQTGENLYRQIKIQYDSTGQLSGLISE 256 Gloeothece verrucosa PCC 7822
WP_015193044      207 PEKIILNVPSIIPMNQTFEMLVGKQITDNLYKQIKVQYNSSGKLSELTSE 256 Stanieria cyanosphaera
Q119K0            209 PDAIVINVPQQLKIGEEFEILVGKMVIENKYKRMIVKYDKNGKFIQLISE 258 Trichodesmium erythraeum IMS101
Q8YKF2            208 PESVIVSIPKQLKLGEAFDIVAGKLITENKYKRLTAKYSNLGDFVLLILE 257 Nostoc sp. PCC 7120
jgi:Cal7507_1200  210 PDSVVVNIPDRVKLGDAFDIVAGKLVAENEYKRLTAKYNHAGDFVLLISE 259 Calothrix sp. PCC 7507
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap