1V0E


Conserved Protein Domain Family
End_beta_barrel

?
pfam12195: End_beta_barrel 
Click on image for an interactive view with Cn3D
Beta barrel domain of bacteriophage endosialidase
This domain family is found in bacteria and viruses, and is approximately 80 amino acids in length.This domain is the beta barrel domain of bacteriophage endosialidase which represents the one of the two sialic acid binding sites of the enzyme. The domain is nested in the beta propeller domain of the endosialidase enzyme. The endosialidase protein complexes to form homotrimeric molecules.
Statistics
?
PSSM-Id: 152630
View PSSM: pfam12195
Aligned: 3 rows
Threshold Bit Score: 148.214
Threshold Setting Gi: 75095342
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V0E_B            180 SRSLHLTGGITKAANQRYATIHVPDHGLFVGDFVNFSNSAVTGVSGDMTVATVIDKDNFTVLTPNQQTSDLNNAGKNWHM 259  Enterobac...
ecoli:ACK-0174131 324 SRSLRVYGGITKAANQQVAYIRITDHGLFAGDFVNFSNSGVTGVTGNMTVTTVIDKNTFTVTTQNTQDVDQNNEGRYWSF 403  Enterobac...
O80102            351 PYFRHPTGGITISSGSTTATIVIENHGLKAGDAVNFSNTAATGVSGNMTVASIINRNTFTVTLSSPAGSTINNAGVTWNF 430  Phage #D
1V0E_B            260 GTS 262  Enterobacteria phage K1F
ecoli:ACK-0174131 404 GTS 406  Enterobacteria phage CUS-3
O80102            431 ATR 433  Phage #D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap