Conserved Protein Domain Family
Ste5_C

?
pfam12194: Ste5_C 
Protein kinase Fus3-binding
This domain family is found in eukaryotes, and is approximately 190 amino acids in length. This domain is the penultimate C terminal domain from the protein ste5 which co-catalyzes the phosphorylation of fus3 by ste7. It is involved in the MAPK pathways. This domain is the minimal scaffold domain of ste5. It binds to the mitogen activated protein kinase fus3 before it is phosphorylated.
Statistics
?
PSSM-Id: 403425
View PSSM: pfam12194
Aligned: 14 rows
Threshold Bit Score: 259.885
Threshold Setting Gi: 74690691
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCK71722     648 TTASSILSLKRERADELILVIQLDFDKLKEksggiggvSDYTTIFNTFKALSLKYARLPFCVLNSAGYILKIGQVKQEFS 727  Kazachstania n...
XP_002495742 566 TNISSILSLKRERPDELVVVLQLDFEKIRTk-------NNSLVIFNSLKALVLKFPDMKICIVDSGGFVRTLGRTKDVIS 638  Zygosaccharomy...
CCE93185     421 TTVSSILSLKRDRPDELIVVLQWNLKETNN--------GLALDIYNNVRALSLTYRDLKVCIVNEEGRVANHALAKDFFT 492  Torulaspora de...
XP_002555644 557 TTITSLLSLKRGRPTLLALVLQLDPSRLKD--------AELIGLVNSLMALTFKIRDARLCLVDLEGGIVSQGLVREQLS 628  Lachancea ther...
Q6CKB4       499 TSISSILSIKRATPNELNLVLQLDKRKTNE--------DNIVSIKNVILALTWKFSTFNCCIVDVEGMVINCGTANDVL- 569  Kluyveromyces ...
XP_003645805 510 TRISSILSLKRKIPNDLFIVFQIDPIKLLD--------GDVNTLVNICKALSWKLETAKLCLVDKDGYLVTSCSLKLAIP 581  Eremothecium c...
Q74ZU4       514 ASINSILSLKRRHPDELCLFFQIDTAKVQA--------VDYKILANTCKAILWKFNTAKVALADSNGGIVTMSLLKDFIP 585  Eremothecium g...
CCH61485     650 TNVSLMVSLKRDCPEKMVLVLQLKDNTIPQ--------ETSRLIFNTIFAVRSRLSKMQITIVNEDAMVIYFGEFLDKLD 721  Tetrapisispora...
CCD27039     642 TTISSILSLKRERPDDIIIVLQLDLNKLKLg-------NNSTTLYNSLTALNMKFPNFKICIVDSNSNVLAYGDVMKAVI 714  Naumovozyma da...
CCC68477     615 TTISSILSLKRERPDDVVIVLQIDFKKIKNe-------DDYTTIYNTLKALTFKFPRLKACIVDAERNTLAIEPVADFIK 687  Naumovozyma ca...
CCK71722     728 NLKCVEEWIDLKPT-SKFDPKELKNILH--PEGIQKHIQLVIVSNSSMEEGMSSLLMDYRSFSAPKRRHADEIKIKVGY- 803  Kazachstania n...
XP_002495742 639 TVEDLEDAQKLSEG-NRFEPIWLKNSLY--PDTTLKGLGIAIVSNTPMDTQKSCLLKDYSCFTNEGRRRPRELKIKVGY- 714  Zygosaccharomy...
CCE93185     493 TSDRVLGLKDNNGT-VRFDPKWLKNTFY--PGNITANIGIAVISDISLESDKSCLLMDYKPFARVGRRRPNELKVKIGYl 569  Torulaspora de...
XP_002555644 629 VVKDLKSTVKDHNR-ARFNPADFKNEFI--WENVDK-IGIAVISNTLVESGKSCLFMDYNSFAGINRTRPHELKIHIGF- 703  Lachancea ther...
Q6CKB4       570 --NSLAGPIKSNGN-QPFSPDLLHQLWYrqKQKICKNVGVVVLSNSSMENGKSCLFSDYRIFADAGKRHPNELKIKVGF- 645  Kluyveromyces ...
XP_003645805 582 KLKGLNSLLAEADRsIKFSPADIYQQIY--GAWQRENIGVTIISNSSMETGRSALLMDYSAFCNVGKRRPNELKIKVGY- 658  Eremothecium c...
Q74ZU4       586 IFSSIDHILRRHETrRKLSPNLVYRHFY--GKERLKNVGVCIISNSAMQYGKSLLLMDYSAFCNIGKKRPNELKVKVGY- 662  Eremothecium g...
CCH61485     722 EFNKL--LVKDSSNnIKFSPSWLKKQLNl-SAGSTDNTAIAIVSEAAMKKGSSCLLMDYSPFAAKGKRIANEVKIKVGY- 797  Tetrapisispora...
CCD27039     715 NAADILKCEHKNAGnQNFTPEWLKNVFY--PNCMDQNIGIIVISNTVMELDKSCLFMDYKPFTCLGRRRPNELKIKVGY- 791  Naumovozyma da...
CCC68477     688 NKDELRNLKDREIG-KTFNIPWLKETLY--PSGIRQNIGIVVISNSSMENDKSVLLMDFQPFTCAGRRRPNELKLKVGY- 763  Naumovozyma ca...
CCK71722     804 -LNVDYSDKIDELLEINSWEFMLEALCYNFSLNFDEDDDGV 843  Kazachstania naganishii CBS 8797
XP_002495742 715 -LNLDYSDKVGELVELESWNNFLEALSYSFGLAFGDDDDDD 754  Zygosaccharomyces rouxii
CCE93185     570 lLNVDYSKRIEELVEVGSWNQILEALSYSFSLAFGDDDEDD 610  Torulaspora delbrueckii
XP_002555644 704 -LNVDYTDCISELVEVASAHDLLETLCYGFNLSFEEEDDNN 743  Lachancea thermotolerans CBS 6340
Q6CKB4       646 -LNVDYSDNIKELVEIQDWNELLEAVAYSFNLSFDDDLDSS 685  Kluyveromyces lactis
XP_003645805 659 -LNADYSDKVYELVETDKWNDVFEVICYSFNMAFGQDALTD 698  Eremothecium cymbalariae DBVPG#7215
Q74ZU4       663 -LNTDYSDQVFELVETGGWGDVLEVVCYSFNMAFGQDDYSD 702  Eremothecium gossypii
CCH61485     798 -LNVDYTDQITELVEVGGWKFVLEMLCYSFSLNFEDDDDES 837  Tetrapisispora blattae CBS 6284
CCD27039     792 -LNVDYSDEINELVEIESWNYLLETLCYSMSLNFDDEDDEN 831  Naumovozyma dairenensis CBS 421
CCC68477     764 -LNVDYSEKVNELVEIESWCSLLETLCYSLTLNFDDDGDTY 803  Naumovozyma castellii CBS 4309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap