2KA4


Conserved Protein Domain Family
STAT2_C

?
pfam12188: STAT2_C 
Click on image for an interactive view with Cn3D
Signal transducer and activator of transcription 2 C terminal
This domain family is found in eukaryotes, and is approximately 60 amino acids in length. The family is found in association with pfam02865, pfam00017, pfam01017, pfam02864. There is a conserved DLP sequence motif. STATs are involved in transcriptional regulation and are the only regulators known to be modulated by tyrosine phosphorylation. STAT2 forms a trimeric complex with STAT1 and IRF-9 (Interferon Regulatory Factor 9), on activation of the cell by interferon, which is called ISGF3 (Interferon-stimulated gene factor 3). The C terminal domain of STAT2 contains a nuclear export signal (NES) which allows export of STAT2 into the cytoplasm along with any complexed molecules.
Statistics
?
PSSM-Id: 371951
View PSSM: pfam12188
Aligned: 8 rows
Threshold Bit Score: 83.6933
Threshold Setting Gi: 13633965
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KA4_B         5 VPEPDLPHDLRHLNTEPMEIFRNS-VKIEEIMPNGDPLLAGQNTVDEVYVSRPS 57  
XP_005206618 792 MPEPDLPYDLRHLNTEDMEIFRNS-MRIEEIMPNGDPVLPCQNTMDEADIFNPS 844  cattle
EHH20864     786 VPEPDLPCDLRHLNTEPMEIFRNC-VKIEEIMPNGDPLLAGQNTVDEAYVSRPS 838  Rhesus monkey
EHB06535     739 VPDSDLPHDLQHLSTKDMEIFRNT-VNIEDIMPNGDPLLAGQNVMDEPYMSCPS 791  naked mole-rat
Q5XI26       777 LPEPDLPQDLQQLNTGEMEIFRNN-INIDDVMPYGDPVLAGQSIIEEAYRSCPS 829  Norway rat
Q9WVL2       857 PSESDLPEDLQQISVEDLKKLSNP--STEYITTNENPMLAGESSGDETSIPYHS 908  house mouse
EGW12499     740 SPESDLPQDLQQLNMVDMEIFRNNiINIDDIMPHGDPLLADQNIGDEAYMSCQS 793  Chinese hamster
XP_010596330 790 VPEPDLPHDLRHLNIEEMEIFRNSsMKLEEILPNGDPPLPAPSTMDDVYVSCPS 843  African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap