Conserved Protein Domain Family
WSS_VP

?
pfam12175: WSS_VP 
White spot syndrome virus structural envelope protein VP
This family of proteins is found in viruses. Proteins in this family are approximately 210 amino acids in length. There is a conserved NNT sequence motif. These proteins are structural envelope proteins in viruses. This is the beta barrel C terminal domain. There is a protruding N terminal domain which completes the proteins. Three of four envelope proteins in white spot syndrome virus share sequence homology with each other and are present in this family - VP24, VP26 and VP28. VP19 is the other major envelope protein but shares no sequence homology with the other proteins. These proteins are essential for entry into cells of the crustacean host.
Statistics
?
PSSM-Id: 403413
View PSSM: pfam12175
Aligned: 3 rows
Threshold Bit Score: 200.178
Threshold Setting Gi: 17016707
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL33006   1 MHM---WGVYAAILAGL-----TLILVVISIVVTNIELNKKL---------DKKDKDAYPVESEIinltingvaRGNHFN 63  Shrimp white spot s...
AAL33423   1 MDLsftLSVVSAILAIT-----AVIAVFIVIFRYHNTVTKTIethtdnietNMDENLRIPVTAEV---------GSGYFK 66  Shrimp white spot s...
AAL33313   1 MEFgnlTNLDVAIIAILsiaiiALIVIMVIMIVFNTRVGRSVv-------aNYDQMMRVPIQRRAkvms----------i 63  Shrimp white spot s...
AAL33006  64 FVNGTLQTRNYGKVYVAgQGTSDSELVKKKGDIILTSLlgDGdHTLNVNKAESKELELYARVYNNTKRDITVDSVSLSPG 143 Shrimp white spot s...
AAL33423  67 MTDVSFDSDTLGKIKIR-NGKSDAQMKEEDADLVITPV--EG-RALEVTVGQNLTFEGTFKVWNNTSRKINITGMQMVPK 142 Shrimp white spot s...
AAL33313  64 rgERSYNT-PLGKVAMK-NGLSDKDMKDVSADLVISTV--TApRTDPAGTGAENS-NMTLKILNNTGVDLLINDITVRPT 138 Shrimp white spot s...
AAL33006 144 L-------NAtGREFSANKFVLYFKPTVLKKNRINTLVFGATFDEDIddtnrhyllSMRfSPGNdLFKVG---------E 207 Shrimp white spot s...
AAL33423 143 I-------NP-SKAFVGSSNTSSFTPVSIDEDEVGTFVCGTTFGAPI---------AAT-AGGN-LFDMYvhvtysgteT 203 Shrimp white spot s...
AAL33313 139 ViagnikgNTmSNTYFSSKDIKSSSSKITLIDVCSKFEDGAAFEATM---------NIGfTSKN-VIDIKde------iK 202 Shrimp white spot s...
AAL33006 208 K 208 Shrimp white spot syndrome virus
AAL33423 204 E 204 Shrimp white spot syndrome virus
AAL33313 203 K 203 Shrimp white spot syndrome virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap