5N9Q


Conserved Protein Domain Family
RST

?
pfam12174: RST 
RCD1-SRO-TAF4 (RST) plant domain
This domain is found in plant RCD1, SRO and TAF4 proteins, hence its name of RST. It is required for interaction with multiple plant transcription factors. Radical-Induced Cell Death1 (RCD1) is an important regulator of stress and hormonal and developmental responses in Arabidopsis thaliana, as is its closest homolog, SRO1 - Similar To RCD-One1. TBP-Associated Factor 4 (TAF4) and TAF4-b are components of the transcription initiation factor complex TFIID.
Statistics
?
PSSM-Id: 403412
View PSSM: pfam12174
Aligned: 50 rows
Threshold Bit Score: 65.9756
Threshold Setting Gi: 586676119
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N9Q_A        41 RPKSPWMP---FPTLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRSTITTLQ 106 
Q6SJR1        80 nhnLRLAR---VTDLLRTVVDHQPGKKTHCLNLHYK-LKRKELTMEEFMRQLRDLVGDQIIRSVISQLP 144  thale cress
F4K4L7       185 NRNPKQVP---FAALLPTLMNQLDKDRALQLRTLYARLKKNEIPKEGFTRHMKDIVGDQMLRMAVSKLQ 250  thale cress
EEF52302     195 KNQFKPIP---FMLLLPTLKPHLDKDRDMQLEILFNKLRRNQVPKEQFVRLMRGIVGDQVLRLAVEQWQ 260  castor bean
XP_006838543 197 fksPSSIP---FGLLMPILCSQLDKDRAMQLMTAFNRLKKAEINKGDFMRLIKGIVGEQTLKQAAQQLQ 262  Amborella trichopoda
XP_009394758 232 tkaaSSIP---FHLLIPILRPHLDKDRSMQLQAIFAKLRNNEVSKEDFLRVIRNIVGDQMLRQAAQKVQ 297  wild Malaysian banana
XP_010235784 156 RGYQPSIP---FNMLIPILQAHLDKDKDMQLQSVWAKLRRNEVHKDDFLRVIRNIVGDQMLKQAAHKVF 221  stiff brome
KRH05607     194 RSTSKQVP---FGMLLPILLPQLAKDRAMQLQTLFAKLKKEEIPKDSFVRLMKGIVGDQMLRLALAKVQ 259  soybean
XP_004238100 210 akqgKQVP---FAMLFPHIQPQLDKDRAAQLQTLYVKLKKNEISKESFVRNMRSIIGDQMLKMAVYKFQ 275  tomato
XP_006651191 378 KPSSPAVTrdmFPMLLTEIQRFVPSPKWQNLQRTYNCFKKGQMKKDQFIRFLRSTIGDKVLTTVAKKLR 446  malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap