Conserved Protein Domain Family
Methyltransf_20

?
pfam12147: Methyltransf_20 
Putative methyltransferase
This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The family shows homology to methyltransferases.
Statistics
?
PSSM-Id: 403390
View PSSM: pfam12147
Aligned: 11 rows
Threshold Bit Score: 522.305
Threshold Setting Gi: 123329170
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAL93281      274 VRDFILRQFAAAPQRVGLLESHRQGPSFEEARALAAPLPALSPRGLYWKAYRAGLRVGGWLSAGVRLGHDTGFDSGSTLD 353 Azoarcus sp. BH72
Q8PD45        276 IRQFVSERFAQPPVRADLRDAHRAGPSFEEAERLAWPSQRNSLQDLRWRGVRAGLRLGGTLSEGIALGLQTGFDSGSTLD 355 Xanthomonas ca...
jgi:Oant_2883 280 IHDFIEVRFAEKPQRADLTDAHIAGHTRDEADRLSSPLPLLTAQGLYWASTRASIAFGALFSEGLKVGKRTGFDSGSTLD 359 Ochrobactrum a...
Q2K5I6        285 VRRFIDARFAEPRAPADLRTAHVQGYTKDEADRLASPLDATSPRGIYWALSRLNIRLGALASEGIKTGVKTGFDSGSTLD 364 Rhizobium etli...
Q6FBP9        273 IRRFVQQSFAENHQPIEIVHADKIGPSCAIAEQLSAPLPKNSWKYWFWNLTKKNLKIGSRFSQGLKIGEDTGYDSGSTLD 352 Acinetobacter ...
Q9I0U4        275 ARRFLLEAFATAPERPSLLDADRLGHTCAEAEALAAPLPKNSPRDLYWRATRAGLRLGSLWSDGVKLGFDTGFDSGSTLD 354 Pseudomonas ae...
Q3A0U2        273 AREFILQAFRSDIDRTALLKADRGGFTRTEYDLLRSPAPW--LKKLNFAAQKFMMRTVGSLSKGIRLGRKTGFDSGRSLD 350 Pelobacter car...
Q3JAE6        273 TRRFLLESFEHPVELPSLLEADRGGYSRTEHDLLRQPTVW--PRQMLFTLQKKSIETVGRLSKGIRVGLRTGFDSGQSLD 350 Nitrosococcus ...
P76092        275 MQSFISRLYANKSQKFDYQHEDCTGPSADRWRLLSGGPVPLSPVDLAYRFMRKAMKLFGTHSSGLHLGMSTGFDSGSSLD 354 Escherichia co...
Q0WD84        276 MKNFIDRLYATAPYAFDYSHEDRWSPSADAYRELQAPPKSRSLEGMFYAALSFGMKTIGRQSKGMLLGYETGFDSGSTLD 355 Yersinia pestis
Q0K9Y0        277 ARRFILREFDMPSAPRSLLDADQIGPFREESDRLASAP--VGLAAWYWRAARANLKLGGILSDGVRLGHETGFDSGSTLD 354 Cupriavidus ne...
CAL93281      354 YVYRNTPTGRGplaPLGRLVDRQYLDAIGWRGIRQRKLNVEELLQKALALLQRDGRPVRVLDIAAGHGRYVLEGLARAPQ 433 Azoarcus sp. BH72
Q8PD45        356 YIYRNQARGRG---PLGRMIDRNYLNAIGWRGIRIRGAHLGELLRATATRLRQAGQPVRVLDIAAGHGRYVLEALGSGAQ 432 Xanthomonas ca...
jgi:Oant_2883 360 YVYENEARGLG---PGGKLIDKQFLEAIGWRGIRQRKVHLEELIGAAIKRLKSEGRSTNILDIACGHGRYVIDAVVRAGE 436 Ochrobactrum a...
Q2K5I6        365 YVYENKPRGLG---PGGRLIDKVFLEAIGWRGIRQRKLHLQELIEYGLKRLKAAGRSTHLLDIAAGHGRYVLDAIEAAGV 441 Rhizobium etli...
Q6FBP9        353 FVYRDQPESTN---ILGKMIDRQYLNAIGWRGIRIRKQHIEQLLPVYAEKLIAADQPLKILDIAAGHGRYILDAVAKISK 429 Acinetobacter ...
Q9I0U4        355 YVYRNQPCGSG---PLGRLIDRNYLDSIGWRGIRQRKLHVEELLRLAMQRLREEQREVRIVDIAAGHGRYILEALQGVEP 431 Pseudomonas ae...
Q3A0U2        351 YVYENRARGIG---PIGKFIDRGYLDAIGWRGIRMRRQHLEKQLTRTIARITDSGQPVHLLDVATGCGRYVLNVLKNHDD 427 Pelobacter car...
Q3JAE6        351 YVYENRARGLT---PVGKWIDHAYLNTVGWRGIRIRRKHLQELLQKAIEDQLQKHDKIEIVDVATGCGRYVLEVLEKLPQ 427 Nitrosococcus ...
P76092        355 YVYQNQPQGSN---AFGRLVDKIYLNSVGWRGIRQRKTHLQILIKQAVADLHAKGLAVRVVDIAAGHGRYVLDALANEPA 431 Escherichia co...
Q0WD84        356 YVYRNQPEGNG---ILGRMIDHNYLNSVGWRGIRVRKVNIQQMIEQAVAKIQLSHMPVRVVDIAAGHGRYVLDALEKQQG 432 Yersinia pestis
Q0K9Y0        355 YVYRNAPSGRG---KLGRLADQQYLDAIGWRGIRQRKVHAEALIAEAVRRLRAGGMPVRIVDIAAGHGRYVLEALGALDG 431 Cupriavidus ne...
CAL93281      434 R---VEAILLRDFSEINVRDGSALIAAKGLSDIARFERGDAFDEASVATVRPRPTIGIVSGLYELFPDNDAVRRSLAGMA 510 Azoarcus sp. BH72
Q8PD45        433 R---ADAIVLRDFSPLNVTQGAALIQALGAGDIARFEQGDAFDPVSVGAVDPAPTLAVVSGLYELFADNDQVARSLAGVA 509 Xanthomonas ca...
jgi:Oant_2883 437 L---PDSIHLRDYSPINVLAGNKLIRDRGLEAIAHMEEGDAFNEESLAVVTPQPDLAIVSGLYELFPDNALINRSLSGLA 513 Ochrobactrum a...
Q2K5I6        442 R---PDSARLQDYSPINVDAGRNSIARRGLNDFVSFHQQDAFDGEGLAAITPAPDLAIVSGLYELFSDNAMIAASLSGIA 518 Rhizobium etli...
Q6FBP9        430 R---PQSILLRDYSELNVASGNRLIHSKGLEDIATFQLGDAFDQASLASIEPQVNLAVVSGLYELFSDNDLLRQSLSGLS 506 Acinetobacter ...
Q9I0U4        432 L---PESILLRDYSEINVRDGSALIESKGLAGIARFVKGDAFDRADLAALQPKPSLGVVSGLYELFADNRMVGDSLAGLG 508 Pseudomonas ae...
Q3A0U2        428 Q---KIDALLRDFTAANLEQGHALAAAMGLENV-RFEQADAFDPDTIRPLQPRPNLAIVSGLYELFPDNDMVGASLRGIG 503 Pelobacter car...
Q3JAE6        428 E---KIHARLRDWTPANLEQGRALAAEKGLENV-EFELGDAFDRDGLLAISPQPHIIIVSGLYELFPENDRVAISLAGIA 503 Nitrosococcus ...
P76092        432 ----VSDILLRDYSELNVAQGQEMIAQRGMSGRVRFEQGDAFNPEELSALTPRPTLAIVSGLYELFPENEQVKNSLAGLA 507 Escherichia co...
Q0WD84        433 ----IESILLRDYSDLNVEKGQAMIEERGLSHVAQFRKGNAFDYDSLATLDPAPTLGIVSGLYELFPDNDLIKTSLAGLA 508 Yersinia pestis
Q0K9Y0        432 GaaaVESILLRDYSPLNVEQGRALIAAKDLADVARFEQGDAFDGDSLAALAPAPTLAVVSGLYELFPDNAMVRRSLEGLA 511 Cupriavidus ne...
CAL93281      511 AAVEPGGYLIYTGQPWHPQLEMIARALTSHRGGAAWVMRRRSQAEMDQLVEAAGFDKLEQRVDEWGIFTVSLARR 585 Azoarcus sp. BH72
Q8PD45        510 AAVPPGGYLLYTGQPWHPQLEFIARALTSHRDGVAWVMRRRSQQEMDGLVEAAGFRKVDQRIDAFGIFTVSLAQR 584 Xanthomonas campest...
jgi:Oant_2883 514 RVQKPGSLLIYTNQPWHPQLEMIARALTSHRGGEAWVMRRRTQGEMDQLVEKAGYRKIEQRVDQWGIFTVSIAER 588 Ochrobactrum anthro...
Q2K5I6        519 RAMQPGGLLIYTNQPWHPQLEMIARALTSHRGGQAWVMRRRTQEEMDQLVAAAGFRKLEQRIDQWGIFTVSLAER 593 Rhizobium etli CFN 42
Q6FBP9        507 QAIETGGYLIYTGQIWHPQQEFIARALTSHRKGEAWVMRLRSQAEMDALVEQAGFKKIDQYIDQFGIFTVSIAQK 581 Acinetobacter baylyi
Q9I0U4        509 EALEEGGYLVYTGQPWHPQLELIARALTSHRQGQAWVMRRRTQAEMDQLVAAAGFRKITQRVDQWGIFSVSLAQK 583 Pseudomonas aeruginosa
Q3A0U2        504 DAVEPGGYLIYTGQPWHPQVEMIARVLTN-RDGVPWIMRRRSQAEMDELVRQAGFDKIAMEVDPWGIFTVSVARR 577 Pelobacter carbinol...
Q3JAE6        504 EVLVDRGYLLYTCQPWHPQLELIARTLVN-REGEPWVMRRRTQAEMDELVAAAGLQKQDMRIDEYGIFTVSAARR 577 Nitrosococcus ocean...
P76092        508 NAIEPGGILIYTGQPWHPQLEMIAGVLTSHKDGKPWVMRVRSQGEMDSLVRDAGFDKCTQRIDEWGIFTVSMAVR 582 Escherichia coli K-12
Q0WD84        509 AAIPPGGMLVYTGQPWHPQLKTIAYTLTSHQNGIPWMMRVRSQKEMDTLVEQAGFEKCHQVIDEFGIFTVSLAVR 583 Yersinia pestis
Q0K9Y0        512 RAVPPGGYLVYTGQPWHPQLEFIARALTSHRAGAAWVMRRRSQAEMDELVRAAGFDKVTQRIDPWGIFTVSLARR 586 Cupriavidus necator...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap