Conserved Protein Domain Family
DUF3589

?
pfam12141: DUF3589 
Protein of unknown function (DUF3589)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 541 and 717 amino acids in length. The function of this family is not known,
Statistics
?
PSSM-Id: 403385
View PSSM: pfam12141
Aligned: 50 rows
Threshold Bit Score: 509.042
Threshold Setting Gi: 255726758
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6BT15       124 KCEAkLQSTSVIEIDKAKNIGVSLPEILTNFLKEc--eTNPYYKELSPFFIDELKLQLKFNVVEKYWYRLAGSSVWLEQY 201 Debaryomyces ha...
CCE40237     132 MCSE-LEYEDAFDVTKQAYLDSDFEYFMTKFKQIk--eYAKLLKKAKAKFKPVIPE-------HKQWFRFGGSSVWLSQF 201 Candida parapsi...
XP_001527259 152 MCSE-LEFEDSFEHTGQAYLNANLALLLNKINGIe--eYKNLIQQAKKRFRPTIPE-------QKQWFRFGGSSVWLPQF 221 Lodderomyces el...
XP_007376341 123 MCRN-ILFEDSFEVSEQSYLNANHEIFMNELNKNv--eFVNILKQAKDKFKPTIPE-------EKQWLRFAGSSVWLPQF 192 Spathaspora pas...
Q5AEC6       131 iCSEkLMFPSKIKLTKQQYLPADLQQFLGVLNNMr--pYHDMVEKAKAYFISDLRE-------EKKWFRFAGSSIWLPQF 201 Candida albican...
EMG46220      96 ICQV-LNFEDSFDVSQQDFLDFDLDMFLNKLRQMk--aYYGIVQQAQDYFVSDLAE-------HKKWIRFVGSSLWLPQY 165 Candida maltosa...
XP_004198562 128 KCEK-SHMVKEIGVGRTVESKVALREVLYRFLNEy--eNNAYYDEVSPFFMEHLADQLRSNLFDNSWFRLAGSSIWLEQF 204 Pichia farinosa...
XP_002546906 101 QCGL-LESKNTISINKPIDMKVSLFKILSKLLYDm--kDDEYLKELQPFIIPELLIQLKLNIIDKFWYRFSGSAIWLDQY 177 Candida tropica...
CCE43544     119 QCNR-LQLNSSVMISKAVNMKTPLREVLQNVLNDiesgESAYLAGLKKIILPELRLQLDLNVVDKFWFRLAGSSVWLKDY 197 Candida parapsi...
EDK42946     130 RCHE-IKQELNMFIDKAIDMKTPLDKVLEHLLKElqhgSNPYFEDIQDLILPELKLQVHLGVVDKFWFRIAGSSTWLEDF 208 Lodderomyces el...
Q6BT15       202 GVHFMISRILYSPKGARNQPIISLTYAQIFSKDWKELTN-TKLIVPTNYIEGMEdte--------vidD-QRFEaLKFPY 271 Debaryomyces ha...
CCE40237     202 KVHYMVSRVLYSPSGIANKAYVSFLYVQLFDQDWKELPKgTNLTIPFEKSDSTNwmnldgsvttirgdPqLRYKrVEFPH 281 Candida parapsi...
XP_001527259 222 KVHYMVSRVLYSPQGVPNKAYVSFLYIQIYDENWQELPQgTKLTIPFEEVKVKYqgnydgsftksgaeSkLGFReTEFPQ 301 Lodderomyces el...
XP_007376341 193 NCHYMVSRVLWTPTGIPNKAFASFLYIQLFDTNWQEIPT-MSLEVPFEEQVLKKglrsdgtfdemimsKiLNFReQTFPY 271 Spathaspora pas...
Q5AEC6       202 QCHYMVSRYLYSPNGVANHAFASFLYIQLFDSDWKELPShTTLDIPFEQTEANSifkif-----kpkqKyANFRnSTYPQ 276 Candida albican...
EMG46220     166 NCHYMVSRILYSPNGIANYGFVSFLYIQLFDTDWNELPP-MKLEIPFEDSIVKEssqyggwvsnveesHfLNFRtVEFPH 244 Candida maltosa...
XP_004198562 205 GVHLMISRVIYTPKQSRSQPSLSLTYAQLFTKDWKELVD-TRLVVPTNDPENPYgd-----------sD-DNYRvIKFPC 271 Pichia farinosa...
XP_002546906 178 QVFFMISRIIYSPKGIKNQPVLSLTYAQIYDKNWNEIHG--KLVVPSNNLNKQQq------------qQ-ESFKdLTFPC 242 Candida tropica...
CCE43544     198 GVHYMVSRIMYSPKGTRNSPILSLSYAQLYDENWNELVG-TRLLLPKAHNSPT-----------------GERHiLNFPQ 259 Candida parapsi...
EDK42946     209 GVHYMISRVLYSPRGIRSRPIVSLTYAQIYDKDWNELVG-INLVIPPIKNGTHVeene------gkatK-KNFRlMEYPR 280 Lodderomyces el...
Q6BT15       272 FLPIPFWHDYDNVE-HKYYGPEDPRILLVKNTKGYLEPLIIFNAYHRKLSRYDDDEDDGLVLKQDFYRSMFMSWPWQFQK 350 Debaryomyces ha...
CCE40237     282 ILPIPIDYAMQTENeKYYYGPEDPRIILRENPLGFEEPLIVFNMKELKIVK----------------RIMFLYLPFS--- 342 Candida parapsi...
XP_001527259 302 ILPIPFDYSLKTEKnKYYYGPEDPRILLHENPLGFEEPLIVFNMKDLKIEK----------------RTMFMYKPFS--- 362 Lodderomyces el...
XP_007376341 272 ILPISFDYQLDVPNgKYYYGPEDPRVVLRANPLGFDEPLIVFNMKDLKLVK----------------RVMHTYLPFS--- 332 Spathaspora pas...
Q5AEC6       277 ILPIPFDYKLPIETkKYYYGPEDPRILLRSNPLGFDEPLIVFNMKGLKLTK----------------RVMYSYLPFS--- 337 Candida albican...
EMG46220     245 ILPISFDYETGSGSkNLYYGPEDPRIVLRTNPLGFEEPVIVFNMKDLELRK----------------RVMHLYLPFS--- 305 Candida maltosa...
XP_004198562 272 FLEIPFWHDYSNTN-NKYYGPEDPRITLVKNKKGYEEPLIIFNAYHRKL----MKDEKSGEVKPAFFRSIFMCLPWQRQK 346 Pichia farinosa...
XP_002546906 243 FLRIPFFHDYDQTS-GKYYGPEDPRLTLV-NVNGYEEPLIIFNSYNRKFIDADDDEDIGLGKEIKFFRSMYMCYPWKFQL 320 Candida tropica...
CCE43544     260 IVPIPFWQDPEINE-DQYYGPEDPRLILIKNEGGYDEPLILYNSYNCKMDTYDDDEDEKLVTTQRCYRAMSICWPWQFDE 338 Candida parapsi...
EDK42946     281 FVAIPFWHDVDQFD-NRYYGPEDPRLILVMNEHGYEEPLLVYNSFYVDMRPYDDDEDLGEPKTQEFFRTMFICWPWQLGE 359 Lodderomyces el...
Q6BT15       351 GKPNTDGMGNkEFDDKLYNKAIELKIKNIP-RQKKQKNWTPFISDNLRTIHG----YDKFVNFVYRWANFEVLKCDLIDd 425 Debaryomyces ha...
CCE40237     343 ------------------KTLNLLKKRTDK-YAKIEKNWTPFISPNQKSQN--------KLNFIYSIVPLEVLVCEID-- 393 Candida parapsi...
XP_001527259 363 ------------------NILKLLKKRNEK-YAYVEKNWTPFFNPVLAKKD--------QINFIYTIVPLSILTCNVQ-- 413 Lodderomyces el...
XP_007376341 333 ------------------NKMQVLRKRTEK-YANIEKNWTPFISKIKSVNDnqqepGDLKLNFIYSIMPLEVLVCEID-- 391 Spathaspora pas...
Q5AEC6       338 ------------------NTLKLLKKRREP-FANIEKNWTPFKSVAQPSKT------QTTIHFIYSMIPLEVLACDID-- 390 Candida albican...
EMG46220     306 ------------------NHLTTLTKRKES-FSHIEKNWTPFFDSPNGPHR--------KIRFIYSIEPLEIVECDIH-- 356 Candida maltosa...
XP_004198562 347 GKTNVDDDEDsEYKNRIYSKVTELRVVNQK-RREIQKNWTPFITYSKRAEKG----YDETVDFVYSWSNLEVLRCGLTQn 421 Pichia farinosa...
XP_002546906 321 DKSNVEGISTqEYNDHIYNKIIEFKIKKYEtSFSNQKNWTPFISSSDKSK----------IKFVYRWTNLDILSCDLT-- 388 Candida tropica...
CCE43544     339 QKN---------------SKRVELKLENY--RLRTQKNWTPFTSPLDRQVDG----YDSHIYFVFRWANLDILKCDL--- 394 Candida parapsi...
EDK42946     360 DK--------------VHNKVVELKIENSE-PMRAQKNWTPFISFEDRNEVG----YDRHINFVFRWANLEVLKCTL--- 417 Lodderomyces el...
Q6BT15       426 SGSCSFTYRLNHriSTESQVGPLRGGTELKNI--NDLIRTqtdlPLEKLL--PPH-REIWVGFARAHLDKCGCGNNMYRP 500 Debaryomyces ha...
CCE40237     394 TAVCDFLQNPKK--KKKNFVGALRGGTQLVSLplDK-LPT----AVRDSLhiPAN-RNVFLGWARAHLNKCGCGESMYRP 465 Candida parapsi...
XP_001527259 414 LGICDYLQKGAK--KNFNYVGALRGGTQLVPLplAD-LPA----SLKSQLavPKN-RQIYLGWARAHLNKCGCGESMYRP 485 Lodderomyces el...
XP_007376341 392 TAVCDFLQKPEK--DDYDFVGPLRGGTQLVPLplSDILPA----SIKEKFtlPDN-RQIYLGWARAHLNACGCGESMYRP 464 Spathaspora pas...
Q5AEC6       391 SGLCDILQKPAK--HDFNYVGGLRGGTQLVSLplNETIPS----EIRAKLpiPKN-RQVYIGWARTHLNNCGCGDSMYRP 463 Candida albican...
EMG46220     357 SGVCDNLQTQYK--NDKNFIGDLRGGTQLLPLpiDDFLPD----SMKPYFksLEN-RKVYIGWAREHLNQCGCADAMYRP 429 Candida maltosa...
XP_004198562 422 PGECKRVFRAK---SDDASVGPLRGGTELVSL--NELLSHqskfPSEKII--PKG-REIWIGLARTHLNGCGCGSAFYRP 493 Pichia farinosa...
XP_002546906 389 TGFCEFEYKMNKtlSPKNKVGPLRGGTQLVNL--SDIIP------DKSIL--LPT-REIFVGFARTHLDDCGCGKTMYRP 457 Candida tropica...
CCE43544     395 QGSCSYDYRFNTslSPKNQVGPFRGGTQLVNL--NDLVT-------------VKDnKEIWVGFARAHIDDCGCGSSMYRP 459 Candida parapsi...
EDK42946     418 DGSCHFEYRFDEslSVKNEVGPLRGGTQLFNL--HSIIP-------------FNSdKEVWVGFARAHIDYCGCGKAIYRP 482 Lodderomyces el...
Q6BT15       501 NMVVLVKDSIstkkdvkdpkspkvikdFYKISHISSSISLDIPIIGWDleNPRDV---------------CIGSNILIPN 565 Debaryomyces ha...
CCE40237     466 NMIILIEDYNeet-----------gkyYYKLGDVSDYIDFGAYVPPWVspKIDPKsgqlie----aeplpCEGRNVLIPN 530 Candida parapsi...
XP_001527259 486 NMILLIEDYNadt-----------ntyYYKIGDVSSYFDFGAYVPPWTlpKKDTKtgqmlfpgddfaprhCEGRNVLIPN 554 Lodderomyces el...
XP_007376341 465 NMIILVEDYDatn-----------dkfFYKLGDVSEYFDFAATVPPWVtpKLDDQgnliee----eypkqCEGRNVLIPN 529 Spathaspora pas...
Q5AEC6       464 NFITLVEDYDdvt-----------dkyYYKIGDISGYFDFAAKIEPWSkqVLDEEgnlye------kaeqCQGRNVLIPN 526 Candida albican...
EMG46220     430 NMITLIEDYDpkh-----------nkyYYKIGDVSSYFDFNSVITPWIvlEADDDgnite------skhlCIGRNVLVPN 492 Candida maltosa...
XP_004198562 494 NLVILVKDDPanipgsed-sdfalmedFYKVSHISSSISFNVPILGWDinKPQDL---------------CSGSNVFIPN 557 Pichia farinosa...
XP_002546906 458 NLVILVKDIIdd-------------qiYYKVSHISPSLSFDIPIPGWS--EPDDL---------------CYDLNILIPY 507 Candida tropica...
CCE43544     460 NLVVIVKERKdl-------------rnHYKVTHISSSLSFNMYVPGWDllYPENS---------------CLRSSVLIPN 511 Candida parapsi...
EDK42946     483 NLVVVTKETVdt-------------esHFMVTHVSSSLSLNVSVGGWDlqTPEAR---------------CFRSSILIPN 534 Lodderomyces el...
Q6BT15       566 GISSWNIKSIRena-------------------------------------ktgFFETDDYMTLSLSISDFTVHTINIKG 608 Debaryomyces ha...
CCE40237     531 SIAYWDIESVTrdgktlkn---------------------------fdqltsldSVSINDYMGVTLSAADQDVSIVHLRG 583 Candida parapsi...
XP_001527259 555 SIAYWQIKSVTtnngrktien-----------------------yqdsafalssTVSFNDYMGVTLSAADQDVSIVHLKG 611 Lodderomyces el...
XP_007376341 530 SIAYWDIAGIIkdnilyprkffhriptdeeiadkkaakvmkqkagsfkrsnifgDVIINDYMGVTLSAADSDVSIVHVKG 609 Spathaspora pas...
Q5AEC6       527 SIAYWDVGSIKlagteyqkhdfkd-----------------mfssgkvsdfnanEIVFNDYMGVTLSSADRDVSIVHVKG 589 Candida albican...
EMG46220     493 SIAYWDIESVIyddvsytrdklt-------------------glgkfpdgttkdSFFFVDHMGITLSSGDRDVRIVHLRG 553 Candida maltosa...
XP_004198562 558 GISYWWIKNIKed---------------------------------------qgSFKTDDFMTFSLSLADYTVHSVDVKG 598 Pichia farinosa...
XP_002546906 508 SISKWDISSLKki---------------------------------------esNYKVKDELILTLTISDETIHKLNIRG 548 Candida tropica...
CCE43544     512 GISQWITHKDSs------------------------------------------GALIDDYLTLTLSVSDYTIHRVNVKG 549 Candida parapsi...
EDK42946     535 GISQWNVEKDPq-----------------------------------------sNAILEDYLTITLSITDFTVHRINIKG 573 Lodderomyces el...
Q6BT15       609 LLNQILnlndkslfmpidsdsedesfstniknlnipdAsIVDDPRRNNLLWLTGYNNDNVLCALDSSAKF 678 Debaryomyces hansenii
CCE40237     584 LLNYIIkl---------------------------psLfDESTAVYNRDQFNIRGSDWNYKCAMKASKEY 626 Candida parapsilosis
XP_001527259 612 LLNYIVkl---------------------------psLfDEETVVLSDTNFGIRGSDWNNKCAMYLSHRY 654 Lodderomyces elongisporus...
XP_007376341 610 LLNYILkl---------------------------psLfEDSSVIDNDSIFQQRGYDYNNKCAMQASDDY 652 Spathaspora passalidarum ...
Q5AEC6       590 LLNYILql---------------------------psLvDDSLVINKEWTFQKKGHDLNVRCAMIASKEY 632 Candida albicans SC5314
EMG46220     554 FLNYLFql---------------------------psFsNSDLIVNTHNEFQVYGFDMNVKCAKWVNKEY 596 Candida maltosa Xu316
XP_004198562 599 LLNAILqlddktl-----------------fnsaeksNdAYGSEANVIPPSRFYHNNVNIQCAIDKSMEF 651 Pichia farinosa CBS 7064
XP_002546906 549 LFQSILnlndnslf----------------kipssnpKlPSSSKSTDSHLKYLGYNNDNLMCALKGSDEF 602 Candida tropicalis MYA-3404
CCE43544     550 LLKELIn-----------------------------wG-----VLDYDVMASTHHANDNLVCALQSSFEF 585 Candida parapsilosis
EDK42946     574 LLKEIIn-----------------------------lG-----VLKSHQPAWFMASNDNIVCAIQAATEF 609 Lodderomyces elongisporus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap