3E9L


Conserved Protein Domain Family
PRP8_domainIV

?
pfam12134: PRP8_domainIV 
PRP8 domain IV core
This domain is found in eukaryotes, and is about 20 amino acids in length. It is found associated with pfam10597, pfam10596, pfam10598, pfam08083, pfam08082, pfam01398, pfam08084. There is a conserved LILR sequence motif. The domain is a selenomethionine domain in a subunit of the spliceosome. The function of PRP8 domain IV is believed to be interaction with the splicosomal core.
Statistics
?
PSSM-Id: 403380
View PSSM: pfam12134
Aligned: 18 rows
Threshold Bit Score: 367.447
Threshold Setting Gi: 134065833
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E9L_A                      1 EPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKW 80  
WGS:AAFB:cds.EHI_060350A 1703 nPSLSITNYGELFTNQIIWFVDHSNIYRVTTHKTFEGNHITKPLNGCIFIFNPRTGGVHLKIIHSSEWEGQKRIGQLKHW 1782 E...
XP_001330664             1750 EPALNSTNFGELFGNKITWIVEDKHVYRVKIQKTFEGNYTTSPVNGGVFIMNPATGQLFLKIITTKAWQQQKRLQQLAKW 1829 T...
EDK35997                 1160 ETFLNSSNYAELFSNETQFFIDDTNVYRVTVHKTFEGNLTTKPVNGCLFMLNPKTGQLFLKVIHTSVWAGQKRLGQLSRW 1239 M...
XP_001386263             1833 EAYLNSNNYAELFNNETQLFVDDTNVYRVTVHKTFEGNLTTKPINGSIFILNPKSGQLFLKVIHTSVWSGQKRLGQLAKW 1912 S...
XP_001525158              644 EAFLNSNNYAELFNNDTQLFVDDTNVYRVTVHKTLEGNLATKPINGCVFILNPKTGQLFLRVIHTSVWAGQKRLSQLAKW 723  L...
ESW95916                 1818 EAFLSSSNYAELFNNENKLFVDDVNVYRVVTHSTFEGNTAVKCLNGALFILNPRTGQLFLKIIHSSAFQGQKRRTQLSKW 1897 O...
Q75D15                   1824 EPFLNSSNYAELFSDETKFFVDDTNVYRVTVHRTYEGNVATKPINGCVFILNPKTGQLYLKIIHTSVWAGQKRLSQLAKW 1903 E...
Q6FQZ4                   1833 EPFLNSSNYAELFNDDIKLFVDDTNVYRVSVHKTFEGNVATKAVNGCVFMLNPKSGHLFLKIIHTSVWSGQKRLSQLAKW 1912 [...
CAY71142                 1848 ESLLNSNNYAELFDNEAQLFVDDSNVYRVNVHQTFEGNVTTKPINGALFILNPKTGQLFLKIIHTSVWAGQKRLNQLAKW 1927 K...
3E9L_A                     81 KTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNL 160 
WGS:AAFB:cds.EHI_060350A 1783 KSAEEVVKLVRALPIEEQPKQIIVSLRGMLDPLETHMIDFPNILLKGSEIALPFGEIMQMEKVKDAVNKATESMLLMFNM 1862 E...
XP_001330664             1830 KAAEETCALVRTLPPEEQPKQVICTSELLLDPVQSYLSEFPNTVVKGSDMDLPLPAFMKIPKIAEEVIHAPEPKMVLYNL 1909 T...
EDK35997                 1240 KSAEEVAALIRSLPREEQPKRLILTRKGMQQPMEVHTLDFPNLSIRSSELHLPFAASMKVDKLANVVLKAKEPQMVLFNL 1319 M...
XP_001386263             1913 KTAEEIAALIRSLPREEQPKQLIVTRKGMLDPLEVHMLDFPNISIRPSELHLPFASAMKIDKLADIVLKANEPQMVLFNL 1992 S...
XP_001525158              724 KAAEEVTALLKSLPREEQPKQLVVARKGMMDPLEVHMLDFPNISIRRSELHLPFAAVLKIEKLSDVVLRANEPQMFLFNF 803  L...
ESW95916                 1898 KSAEEVAALVRSLPREEQPKQLIITRKGIQDPLEVHMLDFPNIQIRPSELHLPFGAALKIDKLLDIVNMAKEPQMVLFNI 1977 O...
Q75D15                   1904 KPSQEMTALVKSLPKEEQPKQIIVTRKAMMDPLEVHMTDFPNISIRPTELRLPFSAVLSIEKLNDVVMKATEPQMVLFNI 1983 E...
Q6FQZ4                   1913 KTAEEVSALVRSLPKEEQPKQVIVTRKAMLDPLEVHMLDFPNVAIRPTELKLPFSAAMSIDKLSDIVMRASEPKMVLYNI 1992 [...
CAY71142                 1928 KSAEEVAALIRSLPTEEQPKQLIITRKNMSDPLEVHMLDYPNISIRQTELKLPFDASMHVDKISDVVLKAREPQMVLFNI 2007 K...
3E9L_A                    161 YDDWLKTISSYTAFSRLILILRALHVNNDRAKVIL-KPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA 230 
WGS:AAFB:cds.EHI_060350A 1863 YDDWLETVSSYTAFHRAVLLLRGLGINPVKAKKIL-LPNPTISIKPQHQWPTYSDDEWKEIEIKIKDLIIG 1932 Entamoeba ...
XP_001330664             1910 YDDWLDTVSPHAAFRRLMLILRALLMERMKAWDIL-RPSANVVTQQNHLWPTHSADEWAEVEIRLKDLVID 1979 Trichomona...
EDK35997                 1320 YDDWLQSISAYTAFSRVILLMRALGINQERTNLIL-RPDASVITQEHHLWPSFSDEQWIEVEAQLRDLILN 1389 Meyerozyma...
XP_001386263             1993 YDDWLNDISPYTAFSRVILLLRAMGIDQENTKLIL-HPDANVVTQDYHIWPTLTDEQWIDVESQLRDLILS 2062 Schefferso...
XP_001525158              804 YDDWLKSISPYTAFSRTILILRALTIDATNATDILwAPNDE--YRELHIWPTLSDAQWVDRESRLRDLILE 872  Lodderomyc...
ESW95916                 1978 YDDWMKTCSSFTAFNRLVVIMRGLEINKERTKLIL-RPDSSIETKPHHLWPSLSDEQWRNVETQLADLILS 2047 Ogataea pa...
Q75D15                   1984 FDDWLERVSPFTAFSRLILLLRALKANEEKAQMII-KADPTIPFKSHHLWPSFTDQQWIEVELKMRDLILS 2053 Eremotheci...
Q6FQZ4                   1993 YDDWLDTISSYTAFSRLILLLRALKTNEEQAKSIL-LRDPTIVIKEHHLWPSFSDSQWIEIESQMRDLILA 2062 [Candida] ...
CAY71142                 2008 YDDWLKSISSFTAFSRLVLLLRALGIDKVKTKRIL-QPDSKVMVKDHHLWPTLTDTQWMEVETQLRDLILN 2077 Komagatael...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap