5LPN,5SZH


Conserved Protein Domain Family
DUF3585

?
pfam12130: DUF3585 
Protein of unknown function (DUF3585)
This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with pfam00307.
Statistics
?
PSSM-Id: 403377
View PSSM: pfam12130
Aligned: 84 rows
Threshold Bit Score: 97.1765
Threshold Setting Gi: 124481800
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LPN_B        17 IQRRLNEIEAALRELEAEGVKLELALRrqs-----ssPEQQKKLwVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQW 91  
XP_023821640 549 VLDQMKALEAEQARLDNRAGVVEKKLRqlie--tgsdKVEEETL-IQEWFSLVNKKNALIRRQDRLQLLLQEQDLEERLK 625  Japanese medaka
EGI64069     801 IQNELEALEREQNQIDIQAGKLEKQLRaame---sdnEDETERL-MSLWFTLVNKKNALLRRQMQLNILEKEDDLERRFE 876  Panamanian lea...
NP_001137683 839 IDSELEALEREQEAIDQKASNLEAKLRavmgg-npktEETEEQL-LSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYT 916  fruit fly
Q7PKB6       831 PSNELNKLEREQEAIDLKANALEKKLRavmggtmtnvSETEDQL-MSQWFTLVNKKNALLRRQMQLNLLEQENDLEKKYE 909  Anopheles gamb...
EEB12203     829 IQNELEALEREQKQIDKQAALLEKELRkvme--sgnnSEQEEIM-MTNWFTLVNKKNALLRRQMQLNILEKEENLERRFE 905  human body louse
EFA00250     784 IDKEMEDLEREQSAIDEQAAVLEKQLRlvmes-pnsnGEEEEAL-MAKWFMFVNKKNALLRRQMQLNILEKEADLETKYK 861  red flour beetle
XP_003247210 734 IQNEMESLEREQKQIDCQADELEVELRrvmn--tgndREREEFL-MTEWFTLVNKKNALLRRQMQLNILEKEDDLERRYQ 810  pea aphid
ESO00783     720 VATEMEQLEKEQLLIDERAAGLEWELRrvmk--egdrDETEEKM-LKEWFGLVNRKNALIRRQMQLNLLEKEKDLEKKFN 796  Helobdella rob...
KAE8607829   690 VTSELAALELEQRNVDERASVVEKDLRslme--ngsdKEAEETL-IQEWFSLVNRRNALIRRQDELQLLVEEQDLERRFE 766  tropical clawe...
5LPN_B        92 QLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELA 146 
XP_023821640 626 LLNKELRDLMTIKECHKSQAHTQREQLLIQELVSLVNQRDKLVHDMDAKEMGALE 680  Japanese medaka
EGI64069     877 LLNHELRSILAVEDWQKTPEQKMRENLLLEELVSIVNKRDELVHHLDTQER-AIE 930  Panamanian leafcutter ant
NP_001137683 917 MLNQELRAAQSVEDWRKTEVQREKERLLLEELMTIVDKRDQLVQHLHNQEI-AIE 970  fruit fly
Q7PKB6       910 MLNMELRAALSVEDWQKTEEQREKEALLLTELVAIVDKRNELVQNLHSQEQ-AIE 963  Anopheles gambiae str. PEST
EEB12203     906 LLNRELRCILSLEDWQKTEEQKVREALLLDELVSIVNKRDELVHHLDSQEK-AIE 959  human body louse
EFA00250     862 MLNKELQKIASIEDWRKTEEQRNREQMLLDELVQIVNKRDELVHHLDNQEK-AIE 915  red flour beetle
XP_003247210 811 LLIGELRSIIAIEDWQKTEEQRRRENLLLAELVTIVNKRDELVHHLDSQER-AIE 864  pea aphid
ESO00783     797 LLSVELRNIMALPDWQKTEEGQQREKLLLAELVELVDKRDELVQKLDSQEQ-AIE 850  Helobdella robusta
KAE8607829   767 LLSRDLRGLLCIEEFMKSEAQKKREKLLLDELVSLVNQRDGLVRDLHFKGIRAFE 821  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap