6TTU


Conserved Protein Domain Family
Beta-TrCP_D

?
pfam12125: Beta-TrCP_D 
D domain of beta-TrCP
This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found associated with pfam00646, pfam00400. The protein that contains this domain functions as a ubiquitin ligase. Ubiquitination is required to direct proteins towards the proteasome for degradation. This protein is part of the WD40 class of F box proteins. The D domain of these F box proteins is involved in mediating the dimerization of the protein. dimerization is necessary to polyubiquitinate substrates so this D domain is vital in directing substrates towards the proteasome for degradation.
Statistics
?
PSSM-Id: 403372
View PSSM: pfam12125
Aligned: 18 rows
Threshold Bit Score: 68.1632
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TTU_T        139 KYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQ 177 
EKC32081       44 KSFDNWTEYDQITFVEHLLSRMCHFQHGQINSFLKPMLQ 82   Pacific oyster
CDS41812       65 EAFSQWNEDDQVDFLCQLLSRMSHAQHSQINRLLEPLLQ 103  Echinococcus multilocularis
XP_015781563   27 KFFDEWTDPEQTDFIQSCLAKMSHHQHSQINTYLRPMLK 65   two-spotted spider mite
ESO03450       42 KLFLTWNSNQQVQFVQELIQRMDHHQHGEIDTFLQPILQ 80   Helobdella robusta
XP_784183      41 EYFDKWIENEQLEYVQALILRMCHYQHGQINAFLKPMLQ 79   purple sea urchin
Q86SD3        157 KHFDTWSEQEQVDFVEHLILRMCHYQHGQINCFLKPMLQ 195  vase tunicate
XP_015853092  271 KYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQ 309  prairie deer mouse
EDV91141       47 QYFRQWSESGQVEFVEQLLSQMCHYQHGQINAFLKPMLQ 85   Drosophila grimshawi
EFX66887       42 KCFDSWPESDQVEFVEQLLQRMCHYQHGHINSFLQPMLQ 80   common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap