2L9D


Conserved Protein Domain Family
DUF3579

?
pfam12112: DUF3579 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3579)
This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 98 to 126 amino acids in length. This protein has a conserved FRP sequence motif.
Statistics
?
PSSM-Id: 403365
View PSSM: pfam12112
Aligned: 40 rows
Threshold Bit Score: 133.451
Threshold Setting Gi: 291583607
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2L9D_A                   9 GIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADR-KLRYSPYLKP-RVIEGVRCLAVDLKLKDTNPEGFNQLMHFAT 86  Methy...
WP_015832961            10 EQQEVIIEGNTRAGKPFRPSDWVDRMCSTYATFGEDR-KLKYSPYLKP-RVVNGVRCLAVDLKLKVVNPEGYAQLMHFAD 87  Methy...
hku:LHK_01858            4 NPYEIVIQGMTSEGRVFRPSDWAERLSGILASFESDQkKLEYHAYVRP-LMLENVRCVAVDKKLEKIDPRVFQFLMSFAH 82  Larib...
Q7NWJ9                   4 NPYEIVIQGLTSEGRTFRPSDWAERLAGILASFDTNQ-KLSYHAFVRP-MLLEGVRCVAVDKKLEKVYPQIFQFLMDFAK 81  Chrom...
Q9K1L0                   5 NPYEVVIHGTTSSGKIFRPSDWAERLCGILSSFTKDH-RLSYSKWVRP-ILVDNIRCVAVDKKLETDNPQMFRFLMDFAA 82  Neiss...
PRJNA52553:THIAE_03750   3 qhCKFIIEGVTEDGRKFRPSDWIDRISSLMASYGASH-RLVYSDLMHP-ELYNGQKCLIIDTELEIKNPSMFEYVMNFAK 80  Thiom...
Q5ZY99                   9 KNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKn--sRIYYSPLLQPsVNSEGYKCVLLDPKLKESSPQVYQAIMDFAK 86  Legio...
jgi:Galf_1988            4 NLNEWVILGITSEGEVFAYPDWAERLCGMLAQQSds-nRISHSDYLHP-MNIDGLPAVVMDARLQLADIEAYTAVCQFAK 81  Galli...
WP_014703094             3 aTEKVLIKGLTEDGSKFRPSDWAERLCGAVASYGpg-rRIIFHPHVRM-ANLEGVKCVVIDALLEQKDEMLFEFLLDFAK 80  Methy...
Q3JEW0                  85 gVKRVFIYGITARDERFRPSNWAERLYYTGASYSSNH-TAIFNPHLNMgVSPQGIKCVMVDAELQLENPMLFDFLIGFAK 163 Nitro...
2L9D_A                  87 ENQLNILDA 95  Methylobacillus flagellatus KT
WP_015832961            88 ENQLNVLDS 96  Methylotenera mobilis
hku:LHK_01858           83 DNDLRVLDC 91  Laribacter hongkongensis HLHK9
Q7NWJ9                  82 DNDLRVVDC 90  Chromobacterium violaceum
Q9K1L0                  83 DNDLRVIDC 91  Neisseria meningitidis serogroup B
PRJNA52553:THIAE_03750  81 SNNLKMTKV 89  Thiomicrospira aerophila AL3
Q5ZY99                  87 ANNLKICGE 95  Legionella pneumophila subsp. pneumophila str. Philadelphia 1
jgi:Galf_1988           82 DNNLKVRSg 90  Gallionella capsiferriformans ES-2
WP_014703094            81 ENQLQTERv 89  Methylophaga frappieri
Q3JEW0                 164 DNKLVMRDQ 172 Nitrosococcus oceani ATCC 19707
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap