Conserved Protein Domain Family
DUF3572

?
pfam12096: DUF3572 
Protein of unknown function (DUF3572)
This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 100 amino acids in length.
Statistics
?
PSSM-Id: 403352
View PSSM: pfam12096
Aligned: 42 rows
Threshold Bit Score: 70.6467
Threshold Setting Gi: 294476975
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA229194:W911_10185     11 QDAETVGLAALAFLAEDAPRLGRFLALTGIGPDQLRSAADAPETLLAVLDHLLGDESLLLVFASTRGIRPETLVPAREAL 90  Hy...
Q1GEL1                      6 DRAEVLGLKALTWLAGNEELLPIFLGSSGASLSDLRDRVNDPEFLGAVLDFLLMDDSWVMAFCDHEGVPYPSLVEARATL 85  Ru...
Q166K7                      6 ESAEVVALQVLAWLAGDEELLPVFQGSSGASTEDLRAGAQDAVFLGSVLDFIMMDDAWVVRCCDDLKLEYTSLMRARQQL 85  Ro...
DSMZRoselon:roselon_00036   4 EIAETRALQVLGWLAGKDDLLPVFMGATGVAEADLRRRAAEPEFLASVLDFVLMDDAWVIGCADAQGWPPTDIVTIRAAL 83  Ro...
Q28ML5                      4 DFAETQALALLAWLAGEEDILPLFMSATGVGEDDLRARAGEPEFLASVMDFLLMDDAWVLRGAEATGIGAQEFAMIRAGL 83  Ja...
Q2W5J9                     21 GDAETIALQVVAWIIGDDTMRDRFISITGCGADDLRNRIDQPAFLGSVLDFLLADESSVLAFADHVGLPPDVAMMARAKL 100 Ma...
Q2RUY5                     11 DAAQALALRALTEIAGDDDLLGRFLVQTGCGPDALRRRITDPAFLGAVLDFILESDATVTRIALALDVPPGRLATARSLL 90  Rh...
Q2N5Y1                     15 ADPDALALQALGWVLTDEDRAARLLALTGLTPDILRERLTDPMVLAAVLDFLSNHEPDLLLAADALDVEPQVLLSAREQL 94  Er...
PRJNA213647:NX02_23585     10 SDATVLALHALAWTLVEPARADRLIALTGIDPLDLRARAAEPPVQAAVLVFLESHEPDLIACAAALDVKPEVLVEARQRL 89  Sp...
Q2W7L8                      9 NSAEVTALRALAWVVTDQDRATRFLTATGCDSDTLRRRAGEAEILGAVLDFLLDDEASLLAFADEVNLPAQSVALARFAL 88  Ma...
PRJNA229194:W911_10185     91 A 91  Hyphomicrobium nitrativorans NL23
Q1GEL1                     86 P 86  Ruegeria sp. TM1040
Q166K7                     86 P 86  Roseobacter denitrificans OCh 114
DSMZRoselon:roselon_00036  84 P 84  Roseibacterium elongatum DSM 19469
Q28ML5                     84 P 84  Jannaschia sp. CCS1
Q2W5J9                    101 P 101 Magnetospirillum magneticum AMB-1
Q2RUY5                     91 P 91  Rhodospirillum rubrum ATCC 11170
Q2N5Y1                     95 S 95  Erythrobacter litoralis HTCC2594
PRJNA213647:NX02_23585     90 E 90  Sphingomonas sanxanigenens DSM 19645 = NX02
Q2W7L8                     89 P 89  Magnetospirillum magneticum AMB-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap