Conserved Protein Domain Family
HSNSD

?
pfam12062: HSNSD 
heparan sulfate-N-deacetylase
This family of proteins is are heparan sulfate N-deacetylase enzymes. This protein is found in eukaryotes. This proteinenzyme is often found associated with pfam00685.
Statistics
?
PSSM-Id: 403326
View PSSM: pfam12062
Aligned: 23 rows
Threshold Bit Score: 763.749
Threshold Setting Gi: 393910291
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P52850         25 GFSLVSMGFLAYYVSTSP------------------------KAKEP--LPLPLGDCSSSGAAGPGPar-ppVPPRPQRP 77   house mouse
EJD75808       19 ITCLSFIFLFTHLVDITEk----------------------rHYRYPaqHIPPYRc---------------pLPNKTGTI 61   eye worm
EGT38087       18 LLAILIVYYICFSVIPTSrp--------------------ppKPRKPpkTMENYTcpfen-------snfvdFDPEKMEF 70   Caenorhabditi...
Q60V90         18 LAIIILLYFLYFSLFSINkk--------------------pgKPRKPpkAVENYTcpfek-------adfsnFKDKKLEF 70   Caenorhabditi...
Q966W3         18 ILALIFLYLIYICLFSNNsk--------------------ppKPRKKpkLVENYTcpfa---------rtegTASENLFF 68   Caenorhabditi...
EFA03870       43 llSIILIIIYSQYIGHSPsylt----------------gliqRSNRP----EPNIRCGTVNGPRIp-----qNHDHKT-- 95   red flour beetle
NP_001163354  179 AITMVSIFYYTHYVDTGVfng------------------liqRDTHP----APIINCRMINSGGKHIrnaspAPDHRS-- 234  fruit fly
XP_001603996   36 LVSMASIFYYTHYIISSPlss------------------lihRDTRP----EPAIRCSTLRGATRLp----kAPDHRS-- 87   jewel wasp
KAE9435686     40 iLSLLSITYFLIYT-STPlsn------------------lirRESRP----EPSIRCQ--VSDGWERp---pAHDHRS-- 89   Apolygus lucorum
XP_015782116   46 TIIIILILTYRLSLGSSSynlvrfppqvtfrcqsnynyeirsRFYSPqqSFNPYIN------------------------ 101  two-spotted s...
P52850         78 PETTR---------TEPVVLVFVESAYSQLGQEIVAILESSRFRYSTELApgRGDMPTLTDHTHGRYVLVIYEnllkYVN 148  house mouse
EJD75808       62 HKRYGfvrnttnflTDEKVLVFVETLYSKLGKQIANILDALKIPLKVETL--TKNLPLLTTAKRGRFSIIIIEnyykYLN 139  eye worm
EGT38087       71 HQKNA---------TDSKILVILDSLFSRNGKSIIQMLNSQKFAFKAEAV--SKNLPVLTNSRKGRYSLIIIEnyykYLN 139  Caenorhabditi...
Q60V90         71 HKNNG---------TDPKILVILDSLFSRHGKSIIQILNSQKFAFKAEAI--SKNLPVLTSAKRGKYSLIIVEnyykYLN 139  Caenorhabditi...
Q966W3         69 HTNNG---------TDARILVILDSLFSRHGKTIIQILNSQKLQFKAEAV--SKNLPVLTTSRRGRYSLIIIEnyykYLN 137  Caenorhabditi...
EFA03870       96 EARLR---------SYPKVLVFVETIYSKLGRDIAELLVHTRIKYKVEVA--GKSLPVLTNLDKGRYGVIVFEnfnkYLQ 164  red flour beetle
NP_001163354  235 EARLR---------IDPKVLVFVETTYSGLGRDIAELLVYNRIKYKIEVA--GKSLPVLTNLDKGRYGVIVFEnldkYLN 303  fruit fly
XP_001603996   88 EARLR---------IDPKVLVFVETLYSRLGREIAELLVYNRIKYKVEVA--GKSLPVLTNLDKGRYGVLIFEnlnkYLQ 156  jewel wasp
KAE9435686     90 SARVR---------IDAKVLVFVETTYSRLGRDIAELLVYNRIKYKVEVA--SKSLPVLTNLDKGKYGVIVFEnlqkYLH 158  Apolygus lucorum
XP_015782116  102 QTKLD---------LDSKVLLFVESRYSHLGKMLIETLEATRIKFKFETL--VKSLPVLTNSDKGKFAVIIFEniekYLH 170  two-spotted s...
P52850        149 LDAWSRELLDRYCVEYGVGIIGF-FRAREHSLLSAQLKGFPLFLHSNLGLRDYQVNPSAPLLHLTRPSRLEPGPLPG--D 225  house mouse
EJD75808      140 LLSWNRQLLDKYCREYGVGIISF-IGNRPNSYINAKVKGSRLTIHTQQRATNLRFNELSRVNFIGKPGAVLQAPEPDk-D 217  eye worm
EGT38087      140 MAKWNRQLLDKYCKEYKVPVISFiSSKPEDHLKRIKIKGSSLWMWQNQRIYNLTVSP-SPIHKISRIGAYRNPNVPSspP 218  Caenorhabditi...
Q60V90        140 MARWNRQLLDKYCKEYRVPLFSFiASKPNDQLKRIRIKGSSLWMWQNQRINRLTVSP-SPIHKISKIGAYRNLTTQE--S 216  Caenorhabditi...
Q966W3        138 MAQWNRQLLDKYCKEYRVPMFSFmSSKPNDQLKRIKIKGSSLWMWQNQRIQRLAVTP-SIIHRISKIGNYRQFSSSDp-A 215  Caenorhabditi...
EFA03870      165 MDKWNRELLDKYCREYYVGMIGF-ITPEEETFVGSQLKGFPLFIHTNLKLKDAALNAASQILRLTRAGETAWGDLPG--N 241  red flour beetle
NP_001163354  304 MDKWNRELLDKYCREYSVGIVGF-VSPSEETLVGAQLRDFPLFVNTNLRLRDASLNPLSSVLRLTRAGETAWGALPG--D 380  fruit fly
XP_001603996  157 MDKWNRELLDKYCREYSVGIVGF-TPPGEESLVGAQLKGFPLFVHTNLRLKDAQLNAASPILRLTRAGETAWGPLPG--Y 233  jewel wasp
KAE9435686    159 MDKWNRELLDKYCREYSVGIIGF-LLGTEERLVGAQLRGLPLFIHTNLKLKDAALNGGSPVLRLTRAGETVWGPLPG--E 235  Apolygus lucorum
XP_015782116  171 MDKWNREILDKYCREYKAGIVGF-IPNKEGTIPNQEITGFPITIDYNMLIRDFKVDEESTILRLTKPGYLNPGPMLH--H 247  two-spotted s...
P52850        226 DWTIFQSNHSTYEPVLIA----------SHRPAElSmPGPVLRRAR--------------LPTVVQDLGLHDGIQRVLFG 281  house mouse
EJD75808      218 DWILFDV-TNGYEGIVLT----------DDIFGEe-------------------------RASVILDDGSEDGIERILFG 261  eye worm
EGT38087      219 DWVLFEIPSKNFEPVLTG----------TVRNGYe-------------------------RAVVIRDKGAEDGVERVIFG 263  Caenorhabditi...
Q60V90        217 DWILFEI-SENFESILTG----------TVKNGYe-------------------------RAVVLRDLGREDGVEKVIFG 260  Caenorhabditi...
Q966W3        216 DWILFET-SEKFESVLSG----------TVKSGYe-------------------------RAVVVRDKGLEDGVERIIFG 259  Caenorhabditi...
EFA03870      242 DWTVFQANHSTYEPLEWA----------HRND-DyQ--PTESNVRTp-------------LPTVIQDHGLFDNIQRVIFG 295  red flour beetle
NP_001163354  381 DWAVFQHNHSTYEPVEWA----------QRNTQEyP-ADSVGQVQLp-------------LTTVLQDRGQLDGIQRVLFG 436  fruit fly
XP_001603996  234 DWTIFQANHSTYEPLAWA----------HRDSLDyA------TNKSp-------------LATVMQDHGRYDGIQRVFFG 284  jewel wasp
KAE9435686    236 DWTVFTANHSTYEPLAWA----------NNNSHDwSdPQDHEDT-Lp-------------LSTVIQDHGGFDNIQRVFFG 291  Apolygus lucorum
XP_015782116  248 KVNVFHSNHSSYRPVTKAylfnpetyniKNRTHRySvSSEEESTSVenekfeifstyeetVSTVLQDKGLFDGIQRVIFS 327  two-spotted s...
P52850        282 HGLSFWLHKLVFVDAVAYLTGKRLCLDLDRYILVDIDDIFVGKEGTRMKVADVEALLTTQNKLRTLVPNFTFNLGFSGKF 361  house mouse
EJD75808      262 HNFTHWINKLAFLDSLRYMRESLMYDDLERYIQIDIDDIFVGTSGTRMTKADVDALLQSQYRLRRDITNFTYSLGFSGYY 341  eye worm
EGT38087      264 RNLTDFQVKMCFLDAIWWAMGTKETFQSDRYVQVDIDDIFVGAQGTRIVEEDVRHLLESQKSFRKSVENFKFMLGFSGSY 343  Caenorhabditi...
Q60V90        261 RNLTDFQIKITFLDALWWAMGDEKLFGLDRFVQVDIDDVFVGAQSTRIVEEDVRHLISAQNHFRNFIENFKFLLGFSGSY 340  Caenorhabditi...
Q966W3        260 RNLTDFQVKITFLDALWWAMGNQKSFTLDRFVQVDIDDVFVGAQGTRIVEEDVRKLISTQKEFRNYVQNFTFMLGFSGSY 339  Caenorhabditi...
EFA03870      296 SGLKFWLHRLLFLDSLSYLSHGQLSLSLDRRLLVDIDDIFVGEVGTRLRPEDVKALIATQTRIQAMIPGFKFNLGFSGKY 375  red flour beetle
NP_001163354  437 SSLRFWLHRLVFLDALSYLSHGQLSLNLERMILVDIDDIFVGEKGTRLRPDDVRALIATQKNIAAMVPGFRFNLGFSGKY 516  fruit fly
XP_001603996  285 GGLKFWLHKLLLLDSLSYLSHGQLSLSLNRMILVDVDDIFVGEKGTRLKKDDVLALLATQQRIQALVPGFKFNLGFSGKY 364  jewel wasp
KAE9435686    292 SGLRFWLHRLLFLDALSYLSHGQLSISLNRYILVDVDDIFVGERGTRLRREDVQALLDTQERIQSLVPGFKFNLGFSGKY 371  Apolygus lucorum
XP_015782116  328 SGFDHWINRLLFIDSLSYLSHGKLSRPLDRYILIDIDDIFVGEVGTRVKPNDVRAILEAQSRLQTIIPGFKFNLGFSGKY 407  two-spotted s...
P52850        362 YHTGTEEEDAGDDMLLKHRREFWWFPHMWSHMQPHLFHNRSVLADQMRLNKQFALEHGIPTDLGYAVAPHHSGVYPIHSQ 441  house mouse
EJD75808      342 FRNGDSLEDEGDERLIEVGKHFFWFPHMWKHNHAH-EHNQTYLEAVMTQNKLFAQGMDLHVNSGYAVSPQHAGVYPVHEA 420  eye worm
EGT38087      344 FRNGDDLEDRGDEFLVESAKEFVWFPHMWRHNHAH-EHNFTYLEAIMVQNRIFAQNMHLPVDYPYAIAPQHDGVFPVHEE 422  Caenorhabditi...
Q60V90        341 FRNGDDFEDRGDEILIENAEKFVWFPHMWRHNHAH-EHNFTYLESIMVQNRLFAQNMHLPIDYPYAIAPQHDGVFPVHEQ 419  Caenorhabditi...
Q966W3        340 FRNGDDLEDRGDEFLVENAEKFVWFPHMWRHNHAH-EHNFTYLEAIMAQNKLFAQNMHLPVDYPYAIAPQHDGVFPVHEQ 418  Caenorhabditi...
EFA03870      376 IYHGNSEEDKGDDLILENVDKFMWFSHMWNHQQPHLYDNLTVLMEDMVLNKNFAKEKGIPVDSGYSVAPHHSGVYPVHEL 455  red flour beetle
NP_001163354  517 YHHGTREENLGDDFLLQNVQEFNWFSHMWKHQQPHLYDNLTLLMAEMHLNYAFAVDHNIPTDSGYSISPHHSGVYPAHEL 596  fruit fly
XP_001603996  365 FHHGTSEENLGDDMILENVDRFTWFSHMWNHQQPHLYENVTHLQLDMALNKQFAKEYGIPTGSGYSVSPHHSGVYPVHEG 444  jewel wasp
KAE9435686    372 FHHGNPEENLGDDMLLRNVNKFNWFSHMWNHQQPHLYENQTQLEFDMLLNKNFGKEHGIPTDSGYSVAPHHSGVYPVHEA 451  Apolygus lucorum
XP_015782116  408 YHRGNQEEDEGDDMLIANAHEFWWFCHMWGHSQPHLTENITALEIRMRMNKDFAHSNNIPIDSGYSVAPHHSGVYPVHEP 487  two-spotted s...
P52850        442 LYEAWKSVWGIQVTSTEEYPHLRPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSRELDRSIRGGELF 514  house mouse
EJD75808      421 LYNSWQLIWNITVTSTEEYPHFRPASARRGFIHRNISVLPRQTCGLYTHTQFFHSYPDGFTKLLSNIEGGDLF 493  eye worm
EGT38087      423 MFEAWKKVWNVSVTATEEYPHFKPPTARKGFIHNGIHVLPRQTCGLYTHTQLFDEYPEGFEKVIKSIQGGDLF 495  Caenorhabditis brenneri
Q60V90        420 MYEAWKKIWNVTVTATEEYPHLKPATGRKGFIHSGIHVLPRQTCGLYTHTQFFDEYPEGFQKVIKSIQGGDLF 492  Caenorhabditis briggsae
Q966W3        419 LFRAWRKVWNVSVTATEEYPHFKPATARKGFIHAGIHVLPRQTCGLYTHTQLFDEYPEGFDKVQKSIEGGDLF 491  Caenorhabditis elegans
EFA03870      456 LYTAWKKVWNIRVTSTEEYPHLRPARLRRGFIHRNIMVLPRQTCGLFTHTMLIEKYPGGREKLDESIQGGELF 528  red flour beetle
NP_001163354  597 LYMAWKKVWNVKVTSTEEYPHLRPARLRRGFIHRNIMVLPRQTCGLFTHTMYIDRYPGGRDKLDESIQGGELF 669  fruit fly
XP_001603996  445 LYEAWKKVWNIKVTSTEEYPHLRPARLRRGFVHRGIMVLPRQTCGLFTHTIFIERYPGGRDKLDESIQGGELF 517  jewel wasp
KAE9435686    452 LYAAWKKIWNIKVTSTEEYPHLRPARLRRGFIHRNIMVLPRQTCGLFTHTIMIDRYPGGREKLDESIQGGELF 524  Apolygus lucorum
XP_015782116  488 LYEAWKLVWNVRATSTEEYPHLRPAQLRRGFIHRGIMVLPRQTCGLYTHTIFIDKYPGGRSKLDASIFGGELF 560  two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap