Conserved Protein Domain Family
DUF3540

?
pfam12059: DUF3540 
Protein of unknown function (DUF3540)
This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 212 to 238 amino acids in length. This protein has a conserved SCL sequence motif.
Statistics
?
PSSM-Id: 403323
View PSSM: pfam12059
Aligned: 22 rows
Threshold Bit Score: 182.454
Threshold Setting Gi: 81606457
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
calssnu:BYI23_C001970  44 ATVTGRADRWFLFDAAGGApLRALRAESCLIEPECGDTVLIAAGGPnA------------ISYVLAVLARA-QRSGAALV 110 Burkho...
CAP42798               44 aRLVMGDGTRYAALTPQGA-IWVTPAAGCLLQPAIGDLALVSLMN--G------------QGYILTVLERAaPDRPAEVA 108 Bordet...
jgi:UWK_02695          18 GVVVEIERECFWVAVGDSR-YRAQKAAGCLLYPEVEDKVLVVSSSA-G------------ECYILSVLERT-KSTRNRLL 82  Desulf...
WP_012239395           19 GAVLRVDGPAYIVETESGE-VRAKRATSCLLEPAAGDLVLLTAVN--G------------AHYILAVLERE-EGAPSHLV 82  Sorang...
WP_012238291           17 AIVVGVSGRSLRVRSSSGE-VEARRAASCLLEPALGDEVLVAHHE--R------------GSHVLAVLERD-DAAPARLS 80  Sorang...
WP_012237563           45 tgVVRGTASGLVVELGGGP-VAARRAKSCLVAPDAGDRVLCAVDG--E------------QVFVLAVLEGE-AGATTRIV 108 Sorang...
CAN98642               16 tGSVERVGATLLVRLASSS-CEARRAKSCLVAPEAGDKVLCAIEP--E------------GVYVLAVLDGR-DGAPTKLA 79  Sorang...
Q63K59                 42 ARVTGRVGDWLLLDDHAGR---ARRADGCLLAPDIGDSVLIWTSAPaGaladdddaahapSAYVLAVLARA-GAPQAALA 117 Burkho...
WP_011768460           19 ATIQGGFANDYMVLSERGV-FRANKAYSCLVQPIPGDKVLIANIA--D------------EHYILAIIERP-ETNNMTLS 82  Psychr...
ABM01906               19 GHVKKEVKDVFIVQSESGV-FPAKHAASCLLQPEVDDKVLLSMTD--G------------ELYILAILEK--SSQKSKLK 81  Psychr...
calssnu:BYI23_C001970 111 LPGDVALHTEDGALRveaa-svdLKAARSLTMQAPDIALTGVRGEMKFQRVEAAVQQLHAGFGTLSTVAQQVTSTVGRLI 189 Burkho...
CAP42798              109 LPGDLHLSLPQGRLAvtathgvaLDAGPALDVAAGRLTAALQTADVACQALRLTGDEAFSQWNTRTDIAGSRLDIATRSE 188 Bordet...
jgi:UWK_02695          83 FDGDTELLSPNGNLQlagkqgvnVTSPSQIRIVSTNLQVVAEQSECSISHLSYIGNFLEGKVALVKLMAGKMESIFDCLR 162 Desulf...
WP_012239395           83 SEGDLQIRLRRGSLGiaapdgvhLAAGKDLSMAASTFRVQAKEGHVALELFTFLSKMARGEVDRAKLIGRSLDSALERLS 162 Sorang...
WP_012238291           81 AEGDLEIAAASGRVSvsgrdgvdVITPAEATIAAGSARLSAARAEAVVGVLSLLGDSLTAKVDRIKTVAQSVETVAERLV 160 Sorang...
WP_012237563          109 AEGDMKVQA-TGRLGlgagdqieIAAAREVGLFAGKLQVRAQAAAAAIEEIGLVGRSLEAHLQKAVVVAERMEARADRLV 187 Sorang...
CAN98642               80 TDGDLEVQARGGRIAvcaservdIVGAREVAMTGAEVHVRAKKGAIAIDELGFFGRLVQAEVTKIALVAQEADTILTRLT 159 Sorang...
Q63K59                118 LPGGVVLETGADGLRidap-hiaLAARERIDARAPRVDVSAHRAHVRAAHLDACARSIDGRAHDVRLVARRFTSTIGRAL 196 Burkho...
WP_011768460           83 FPGDVAFEATSGALKltsgkqmsLTSAEKIQSTSTEIGINTANMKVQANECSVVGDKAVSQWREVNSFSSAMNLVTDRLT 162 Psychr...
ABM01906               82 FKGDVCLESDAG-LSlssakalqLTSLQSVSQIAPEINTLSKKHTLTTEQLSAHSQKMTVKSEQVQAHVKELHGMFERVY 160 Psychr...
calssnu:BYI23_C001970 190 QRARDSVRFIDDTDETRAGRVRMQVEERMHVSARHATILAEGQVKIDADKIDLG 243 Burkholderia sp. YI23
CAP42798              189 SHAEHSVRRIAGHEEVCAQSMRHLVDQDWSVHADTADLKACDRAAVTAASVQLG 242 Bordetella petrii
jgi:UWK_02695         163 QKVKRSYREVEDIDQLKAGKIDYNAERLMSLRGKYSVVTAKENIKIDGKMIHMG 216 Desulfocapsa sulfexigens DSM 10523
WP_012239395          163 QRVKRSYRIVEEADHVRAERIDYAAKGNLAIHSENAKITACHVVKIDADQIQVG 216 Sorangium cellulosum
WP_012238291          161 QRLDRAYRFIARSETVRAEYLELEARAAFHVKAETTLVNSGGLTKIDGSQIHLG 214 Sorangium cellulosum
WP_012237563          188 QRAKQAFRFVEALEQVRAGVFDLRAEGLAAVRGENTIVAARTLAKLDGEQVKIG 241 Sorangium cellulosum
CAN98642              160 QRAKRVFRFVEEIDQTRAGTIDLRAQNMIGIRGENAIISARVLAKVDGEQIHLG 213 Sorangium cellulosum So ce56
Q63K59                197 HTLGDCLRRVCGVDELHAARTRWRVDERAHLHARDVTLLADRHVGIDGERIDLG 250 Burkholderia pseudomallei
WP_011768460          163 QRIKNSFKTVEGLDQQTSLNFLQTIGKTLSIRSRDAVITARKDVKIDGERIHMG 216 Psychromonas ingrahamii
ABM01906              161 QKADQVIRWVETIETLNIGNWVQNIKGTLNSRAKNQVITAKGDIKVDAERIHMG 214 Psychromonas ingrahamii 37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap