Conserved Protein Domain Family
Metallopep

?
pfam12044: Metallopep 
Putative peptidase family
This family of proteins is functionally uncharacterized. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found mainly in fungi. Proteins in this family are typically between 625 to 773 amino acids in length.
Statistics
?
PSSM-Id: 371862
View PSSM: pfam12044
Aligned: 23 rows
Threshold Bit Score: 323.537
Threshold Setting Gi: 74871578
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6BJL3         1 MTITLNYQDNEIVSSPTVIISGRTST-GI----TQGIVQVVN--NDNRv---FPPQC--F-------------------- 48  Debaryomyces ha...
Q0U894       137 SW----------VHQQVLLIFGQIGE-TTnk-pLDGSLTVNH--HQGR----FPPTC--W-------------------- 176 Parastagonospor...
Q2UKU5       120 APRIISIADNSWVHQKVLLVYGQIGD-PRqh-pLDGSVTVYH--HQDG----FPPVS--W-------------------- 169 Aspergillus oryzae
Q2GRM7         3 QLDNFPTDEVSEVYQRCVLVSGKCNT-ASaleqNDGHVLVET--GDRFgktlFPEQR--W-------------------- 57  Chaetomium glob...
Q2UIV0        26 PFRIINLSEGDLVHQTCVAVHGECPElDDaadtVFVSVSSSHmfNQ------EPQTVnhW-------------------- 79  Aspergillus oryzae
Q9US12         3 QIILDNISQNETVYNRFVIIHGRVGP-RAs--yCPQTINVKH--HENS----FPEQT--W-------------------- 51  Schizosaccharom...
Q7UR15        40 SIRVENHESDSEVRYSVVLLRGTVAA-DD----ASELTIVNT--NTPAg---SSPVK--V-------------------- 87  Pirellula sp.
XP_001639460  63 AIEV-DLRNGQTLYHPLVLLEGDCHR-KKknekSKLYEKTQH--VDKFs---VSTKD--Kyssssamdhvlvetrtkctk 133 starlet sea ane...
Q29JG9        13 SIEVEQLQDSEEVQHSFLLIKGRLEP-KCsa-aKQLKATLEL--RDES----LEQLT--Q-------------------- 62  Drosophila pseu...
Q9VXV2        13 SIEVEQPLTSERLEHSLLLVKGRLVP-KCst-aRQLKAILDL--PEHLs---QEQLT--Q-------------------- 63  fruit fly
Q6BJL3        49 -EVNNGNFKALIHVSPNEkNKLKIEimdngrmnpfgfpeyshgKPQVVDKSELNINFNPLPQNKPVHLCVLVGKDSQGAY 127 Debaryomyces ha...
Q0U894       177 -PVHDSYFKALVHLEPGW-NRIRLDftspk--------issgnTSVPSHATFMNINYLPLNQSPPLQLAIILGHDSPGTY 246 Parastagonospor...
Q2UKU5       170 -PVTSSHFKALVHLTPGP-NRLRLDfvstk--------lsagsSHPAAHSSWICINYLPLVNAPPLHLVVLLGKDSDGTF 239 Aspergillus oryzae
Q2GRM7        58 -PMCHGNFKALLLLSPGL-NKITI-----------------------------TTQDDASTETPPLHLAILVAKDSPLLM 106 Chaetomium glob...
Q2UIV0        80 -PLHKGQWKALVMLAPGT-NTLIFKlh---------------hARRFLASLQINVNYIPLLQLPPLHLAVLVAKDSPLLI 142 Aspergillus oryzae
Q9US12        52 -VVTDLYFKAIIHVVPGD-NTILF-------------------TTDDGGKLELQVYYQLLVDNPFYCIAFIVGKDSDLSF 110 Schizosaccharom...
Q7UR15        88 -LTDGKRFKALVELSEGR-NAIRL-------------------EHGSASTSELILDFKPQTNPHYVRLIWMTDQSGETDF 146 Pirellula sp.
XP_001639460 134 wPIVDDAFKALVVLIPGS-NLLKVKv----------------cLDGEWRHKELSLIYQPLQLERFVRVVYIKCRDSDGTF 196 starlet sea ane...
Q29JG9        63 -LSSAGEFKLLFDLHKGErERQEEPavtsr--------acllqLRSCSGSRLIRFTYKPRSSPYRVQPLYIVCQDEKEEE 133 Drosophila pseu...
Q9VXV2        64 -LSAGGEFKLLFDLEQANrEEEEEEsac------------lleLRSCTATRTISFSYRPRRSSYRVQPLYLLCQDEEKTL 130 fruit fly
Q6BJL3       128 DMPHYRLKr--GEPANLQTAIKKLKVGGRLMQSFTQDDMRSTGMSNRSFQFVEETVSNQGIFgy----tvDSPTPHQEIK 201 Debaryomyces ha...
Q0U894       247 DAPPERIQ---REGNGLELAIKKFRMAAYLWQAFTGEQMNRYGFGRRCFRFEDAWEPGTLSYqd-----wGNTEYRTQAK 318 Parastagonospor...
Q2UKU5       240 DATPAEIQ---REGNGLETAIRKYRMAAYLWQAFTGEQMFRNNFGRRCFRFEEEWQSGTLSRrd-----tANGQMRNEAK 311 Aspergillus oryzae
Q2GRM7       107 DCPPAKFGgisSAHSDLSAAIAKFRMTAYMWQALTAEDLRAKGLGRRAFRLEEEWSTDTLSQrsq---qtPTAAAGTVPK 183 Chaetomium glob...
Q2UIV0       143 DCPPAKYGgisTAHSTIDAAISKLRMSAYMWQALTAEDFRQKGLGRRSFRLEEEWSANTTVQaghqattgTKSSMGSVAK 222 Aspergillus oryzae
Q9US12       111 DAPH-------GAKNDIDEGIRKLRCAAYLWQAFTAECMYRNGYGRRSFRIEESVQPDTMSCls----pwGTE--RLTAT 177 Schizosaccharom...
Q7UR15       147 AVPDDTVT---------QDYANRLRTAALLMQTFTAERMKDLGYGPRTFALERDD--------------------KGEVV 197 Pirellula sp.
XP_001639460 197 QAPP-------GSSCDIDVARQKLAFNARLLQSFTAHNLYKHGLGYQTFRLEEDTEGEPLV------------------- 250 starlet sea ane...
Q29JG9       134 QEQEQETN----ARSDHSARCSLIDLNLRLVQCIYAHKLHAAGFANRTFTLNGPC------------------------- 184 Drosophila pseu...
Q9VXV2       131 AQQHEVHS--------------LIDLNLRLVQSIYAHKLHAAGFPNRTFTLNGKC------------------------- 171 fruit fly
Q6BJL3       202 IHVLRSPKTVAELRDPNLAQQNSKGNNTGGLFSHALELIEKTPELsdkfkRLKTAVQCAVLYLDSHFDT----------- 270 Debaryomyces ha...
Q0U894       319 IHVIRSKRSVAEIRDLERAQQYGPGSRKGELFDIAAEAVKDYFHI-----APGSKQYVSCMFLDSTWDT----------- 382 Parastagonospor...
Q2UKU5       312 VHVIRTDKTVAELRDLNIAQQHGPATKKDELFNIAKDAVKGYLHL-----QPGQKQYVSVLLLDSHWDT----------- 375 Aspergillus oryzae
Q2GRM7       184 IHLIRTEKTVAQLRDANLAQQNPHARHPDDLHKIFTAALLAHGAPf----TTHTRPVVAGLILDSHYNTpdttis--pts 257 Chaetomium glob...
Q2UIV0       223 VHIIRSDRNVAELRDADVAQQNPRGRDRDALHRYFEAALAKSGPPf----ESSCRPVVAGLILDAHYSN----------- 287 Aspergillus oryzae
Q9US12       178 INILRSDKTAEEIRSV----------PPDQLFHIAGDAVDKLHLP--------EPWHYMCMFLDTRYDP----------- 228 Schizosaccharom...
Q7UR15       198 VHTWKGDQDKQD---------YYAQAENNRWWQQVRRWINDE--------HPDPMAKNVVLAAYTRKDP----------- 249 Pirellula sp.
XP_001639460 251 -HVFTTALCMEE----------ALALSGGQLYDRFHQELVNSS-------LYDKNCKLWAFMSFTRYNPplpee---fne 309 starlet sea ane...
Q29JG9       185 -RLFRSQLTTEE----------TLAKTEDELWQHFAGEILSCAQW-----GQQLHLKFVAFVACTRYDGaavaasgdlsy 248 Drosophila pseu...
Q9VXV2       172 -CAFRSQLTRKQ----------ALAKSEDELWQHFAGEIIACPQW-----GHQLLLKFVAFVGCTRYDGdavvasgdssy 235 fruit fly
Q6BJL3       271 --KLDMILAHAALGGGNSN-IKLAIFGSHGLHSWPASFPQLTPSFLDGTHLSINEVANDCNQCGTSWECLNITLGAFMHE 347 Debaryomyces ha...
Q0U894       383 --QEKTIRGHAALGGGMAE-LGLGIFGSQALHSYPSSIEEVFQAFHDCTRTDTAFVANDCGESGSNWEAANIGIGAHLHE 459 Parastagonospor...
Q2UKU5       376 --GSQTITGHAALGSGGDD-VKMAIFGSHSLHSYPSSLEEVVDAFSDCTRTDTDFVANDCSEAGSRWESANIGIGAHLHE 452 Aspergillus oryzae
Q2GRM7       258 phHSPLILAHAALGSHDPRgLSLGIFGSHLTYAWPRFLDEVPACLLDPTPPG-DTVGNDNGECDSMWRACAVGQGAFLHE 336 Chaetomium glob...
Q2UIV0       288 --EQSMIMGHAALGCHKPDgISLGIFGSHLTYSWPRFLEEVPVCLTDMTPTG-DTVGNDNGECDTMRGACFVGQGAFLHE 364 Aspergillus oryzae
Q9US12       229 --STQKIRGHVALGGGTDM-HKLGVFGSHSLHSFPSALEYVVPVFSDARRIP-SYLANDANESSTIWECANIGIGAMLHE 304 Schizosaccharom...
Q7UR15       250 --RTGKMLGHTALGGAN-----LGLFGSASMFCWPRDIQSAMDVFQDGTEVDPTHVHDDSAFRGTIWALASTTIGATLHE 322 Pirellula sp.
XP_001639460 310 kdIPMYVKGHTALGGGS-----LALFGTGGLHTWASCIEEVWPCFTDTRMIDKRTLFDDSSRRGTYWANYATCLGAAMHE 384 starlet sea ane...
Q29JG9       249 anIRRHLRGHAALGGGG-----LALFGSAHFYSWPRSFAEIGDCVRSAERVDVARLPDESNYRRTYGGVYASTLGAVCHE 323 Drosophila pseu...
Q9VXV2       236 anIRRHLKGHAALGGGG-----LALFGSAHFYAWPTSFAEIGDCVRSAQRVDIARLPDESNYRRTYGGVYASTLGAVCHE 310 fruit fly
Q6BJL3       348 IGHLLGCPHQVD--GVMLRDYI-WWNRSFMSREVECLRTKSRGqlintNGIWPRV-C-----HWNRLDLIRFFYHDSFSL 418 Debaryomyces ha...
Q0U894       460 TGHLFGCPHQES--GVMLRDYV-TFNRTFSCREPYSTRTKSPGq----RLVLPPDeC-----KWHRLDVLRFRFHPCFRI 527 Parastagonospor...
Q2UKU5       453 VGHLFGCPHQES--GIMLRDYV-RFNRSFMTREPFSTRTKTQGl----KLCLPQDeC-----GWHRLDALRFRFHPCFRL 520 Aspergillus oryzae
Q2GRM7       337 A-------------GIARVVFS-PLGKADEEEDKVS--------------------------VSNPLKSLRYSYEELASR 376 Chaetomium glob...
Q2UIV0       365 VGHAFGAGHTT---GIMARGYSkAWAMNFVAHETNGTAENDA--------------------KWDLQDALKFKSLPHFAL 421 Aspergillus oryzae
Q9US12       305 LGHTLGCPHQPD--GIMLRSYP-IFNRSFTTREFECVRTGSKGl----APVLAKDeC-----SWHHLDMLRFFYHPCFKL 372 Schizosaccharom...
Q7UR15       323 TGHAMGLPHCTDnmGIMTRGFD-HFHRVFTFADPPSKQNKQP------RKFSSEQeA-----YFSPVSASFLRWSPWFQL 390 Pirellula sp.
XP_001639460 385 LGHCFDLAHTPA--GIMGRGFD-DINLVFTLQTTLQKKSSSGS-----GKV-----------VYTRQICIRVTNKPSTAL 445 starlet sea ane...
Q29JG9       324 LGHCFDLGHTLN--GVMGQGFD-YLNRVLTVDQVTEHLPQRIVdqsysSATLPAAgAaagtnTRSRLTQLKLK-QPSSQL 399 Drosophila pseu...
Q9VXV2       311 LGHCFDLGHTSE--GVMGQGFD-YLNRVLTVDQPTEHLPQRIV------------------------DARRGSLANTNSS 363 fruit fly
Q6BJL3       419 PVDakdptygkvqsTTIIPDDnyegsyrTPTLY------NTPRGG--A-LIKSGSGIY 467 Debaryomyces hansenii
Q0U894       528 PID-----------GNVSGDG-------SVQVW------TVDPGQggV-IATSKSGIA 560 Parastagonospora nodorum SN15
Q2UKU5       521 PGD-----------APMSSDD-------SVQVW------PVENGK--I-LITATTSIA 551 Aspergillus oryzae
Q2GRM7       377 FGTk---------gLRLKVTGmngkeysVDNIW--------------K-LFQRGTTSI 410 Chaetomium globosum CBS 148.51
Q2UIV0       422 PGDklvs----ndfRLAHVRIevdfgldNPDIM------SMEGEHpeGlKVSCTAGLA 469 Aspergillus oryzae
Q9US12       373 PSD------------PTYPSD-------IETNY------FVKGET--I-TFVNSTGIF 402 Schizosaccharomyces pombe 972h-
Q7UR15       391 DDS---------------TGVsaksprsRPNV-------EVDEAAklV-RISSSAGIP 425 Pirellula sp.
XP_001639460 446 IRW-----------LSSAPSQdnfkkhnPVVHWghdvcgPVGNCG--S-FAQPEQSPF 489 starlet sea anemone
Q29JG9       400 LDN-----------------------------Y------HGQRRNdsF-YFARNCAVI 421 Drosophila pseudoobscura
Q9VXV2       364 EGG------------SSSSSStssssssAGSGA------ATGNRArlT-KLKLQPSSQ 402 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap