3T6G


Conserved Protein Domain Family
DUF3513

?
pfam12026: DUF3513 
Domain of unknown function (DUF3513)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with pfam00018, pfam08824. This domain has a conserved QPP sequence motif.
Statistics
?
PSSM-Id: 403297
View PSSM: pfam12026
Aligned: 36 rows
Threshold Bit Score: 188.772
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3T6G_B        12 NSEGGWMEDYDY-----VHLQGKe-----EFEKTQKELLe------------------------kGSITRQGK------- 50 
2_pfamImport   2 QEGDLAEDDNDY-----VELQTKe-----DENKQ-------------------------------REVQKEPK------- 33 
6_pfamImport   2 AEREWFKDYKDFvfqklPNLEET------------------------------------------EKPILEGL------- 32 
A5GFW5       592 EEPVQWTPNAEFklarrIQLPQKe-----GESYQRKAPFqkqra-----------------seqpPELIEKNK------- 642 pig
XP_023394560 615 QETLQLAPNAEFklkkcIQLPQRe-----NESYQRSTPFnkqre-----------------ndhfPELVKKNK------- 665 African savanna...
8_pfamImport   2 TTKENVTEDCEY-----VQLQAQkiisgkEVSKKSTDLKpkvflilktmaykesqsfisvlakiqRNMVRMEE------- 69 
AAI46253     372 YEGIPVAEEYDY-----VHLKGMd-----KVQEARPPDKaspgd-----------------peqlEREPPEQQ------- 417 cattle
XP_005010473 669 KTKDDDIEDCEY-----VQLQVLps--------------------------------------skKNVIQSKQ------- 698 mallard
XP_008113473 514 ieengasgcdsklqarikeqlnnltdsfqilvetrdalndckwsldllvikkpqsnpddldrfvmvartipddikrfvai 593 green anole
XP_004918780 646 LPRQKTVDDSDY-----VHLQ-----------------Kkeeferaka---------ifshqqleNKIQTEEKrkgwitp 694 tropical clawed...
3T6G_B        51 --SQ-----------LELQQLKqf----------erLEQEVSRPID-----HDLANWTPAQp------------------ 84 
2_pfamImport  34 --EN-----------VT------------------------------------PTTETTKTfliykrisglkqtnqsrrh 64 
6_pfamImport  33 --GG-----------GCRVEEGrtemshdmaecfqaVSLEITDPEWlplssMNPSSLIPQPlsqqn------------pe 87 
A5GFW5       643 --TN-----------ACG------------------------Q---------NPGSLIPRPlsqqn------------pe 664 pig
XP_023394560 666 --TN-----------VCGQKLPnlee-------kekHISKQRVDKNkdlrtKNPSTLLPQPlslqn------------pe 713 African savanna...
8_pfamImport  70 --CS-----------VE-----------------------------------QVLPSTKKNavrsqq------------- 88 
AAI46253     418 --EA-----------LS--------------------------PGEs--------------------------------- 425 cattle
XP_005010473 699 --EP-----------AKk-------------------------------------------------------------- 703 mallard
XP_008113473 594 iiangkllfrknckdkdgkdqktggkqkllrhtlecqvedesvqksifdkpkenklcsekqradgiedcdysriqkpvgl 673 green anole
XP_004918780 695 esLIsgsekqekkdeLPt--------------------------------iKEPSSPTPKQdvahsp----------esp 732 tropical clawed...
3T6G_B        85 --LApgrtggLGPSD--------------------------------RQLL----------LFYLEQCEANLTTLTNAVD 120
2_pfamImport  65 ghVY------LYSVS--------------------------------PLLRpsntpptlavAPKSEHCRLYFGALQKAIG 106
6_pfamImport  88 krFH------L-----------------------------------------------------SEHCRLYFGALFKAIG 108
A5GFW5       665 krIH------L-----------------------------------------------------SEHCRLYFGALLKAIG 685 pig
XP_023394560 714 kkIH------L-----------------------------------------------------SEHCRLYFGALFKAIS 734 African savanna...
8_pfamImport  89 --------------------------------------------------------dsakkIVVPEQCRLCFGALHKAIA 112
AAI46253     426 --LV------LPTGD--------------------------------LQLL----------HFYAGQCQGHYSTLQAAVA 455 cattle
XP_005010473 704 --IA------L-----------------------------------------------------PEHCRLCFSALQKAIA 722 mallard
XP_008113473 674 eqAQ------LFPSPckteennvklklkdsppttqdskqgpatkmelSNIC----------RLYFg-------AVQKAIS 730 green anole
XP_004918780 733 kkFN------L-----------------------------------------------------SEHSCLYFGALQKAIG 753 tropical clawed...
3T6G_B       121 AFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAA 200
2_pfamImport 107 GFVGSLQDDQPPEKFISQSKLVIMVGQRLV---DTLYREAHRKGSNQSLLCKSNHLCALLKQLAVATKKAALHFPDRQAL 183
6_pfamImport 109 VFNSSLSNSQPPEIFITQSKLVIMVGQKLV---DTLCKETQERDVRNEILCGSSHLCSLLKSLALATKQAVLKYPSPAAL 185
A5GFW5       686 VLNGSLSNRQPPETFITQSKLIIMVGQKLV---DTLCKETQERDFRNEILCGSSHLCSLLRNLALATKHAVLEYPSPAAL 762 pig
XP_023394560 735 VFTSSLSNSQPPENFITQSKLIIVIGQKLV---DTLCKETQERDARNEILGCSSHLCSLLKNLALATKDAVLQYPSPEAL 811 African savanna...
8_pfamImport 113 VFNNSLSSNQPPEVFISHSKLIIMVGQKIV---DCLCQEAQLREARSDILHSSSRFCSLLKNLALATKNAAIQYPNADAM 189
AAI46253     456 ALMSSTQAKQPPHLFVPHGKRALVAAHRLVFVGDTLGRLAASAPLRAQVGAAGTALGQALRATVLAIKGAALGYPSSPAA 535 cattle
XP_005010473 723 VFNNSLSNNQPPEVFISHSKLIIMVGQKIV---DSLCQETQERDARNDILHSSSRFCSLLKNLALATKNAAIQYPNADAM 799 mallard
XP_008113473 731 VFHQSLSRDQAPEVFIAKSKLIIMVGQKLV---DTLCQEAIEKTNRNEILCGSSQFCALLKSLAVATKNAAMQYPSPEAM 807 green anole
XP_004918780 754 VFNNSLSNNQPPEIFITHGKLIIMVGQKLV---DSVCQDVKSSEVRNDVLFKSSELCGLLKNLALATKTAAIQYPNPAAL 830 tropical clawed...
3T6G_B       201 QDMVERVKELGHSTQQFRRVL 221
2_pfamImport 184 HEAQEFATQLAQRAQHFRLSL 204
6_pfamImport 186 GHLQTEAQKLEQHTRQFRAIL 206
A5GFW5       763 GHLQAEARKLEQHTQQFRGTL 783 pig
XP_023394560 812 RHLQAEAETLERHTRQLRQAL 832 African savanna elephant
8_pfamImport 190 RELQNKSDELHKYAQQFRAML 210
AAI46253     536 EEMAQCVADLAGQALQFTTLL 556 cattle
XP_005010473 800 KELQNQNDELYKYTQQFRAMM 820 mallard
XP_008113473 808 RELQDQVDGLSKYTQQFRAMM 828 green anole
XP_004918780 831 RDMETRMDELLKHTQIFRama 851 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap