Conserved Protein Domain Family
DUF3512

?
pfam12024: DUF3512 
Domain of unknown function (DUF3512)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 231 to 249 amino acids in length. This domain is found associated with pfam00439.
Statistics
?
PSSM-Id: 403296
View PSSM: pfam12024
Aligned: 40 rows
Threshold Bit Score: 222.482
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGT38831      290 RKGFVKDDMT--SEECL---QSADVKVRDRLSARIPNlkna--------enkANMGFLSER-NGTVVLNVVAGTSS-ENQ 354 Caenorhabditis...
PAV59814      303 RREAYVDDMT--TEDCL---NAAHSKVRDKLTARAPTqp------------nGKLAFLSNK-DGKTVLNVIGDPSR---- 360 Diploscapter p...
VDN50871      303 QRNFVIDNMT--TSSIL---DSTDPSIRRKLATRVPDlsvlpnc-esgrepkAHLAFLDNK-DGAVCLNIVNSVTS-E-- 372 Guinea worm
3_pfamImport    1 RKAAIVDDAT--PVSVL---NSVDSTLRQRLSSRKPNlkkllpntedgiepkCHLAFLDNK-NGAVCLNVINSVES-E-- 71 
ESN92554      283 KFEAIPDELT--ASEILeqvQTAARLAAENLQTHAPN---------------SKIGYLKKEaDGTTVLNILNPDNR-GFI 344 Helobdella rob...
EDV29788      447 KKDFQDHQFTaaKRQLTtsvQAAAKEAANNIAKQSIK---------------TNYGHFKRKrDGTTVLSVVNPSNAdDEY 511 Trichoplax adh...
11_pfamImport   1 EAISFTDADN--EDSVApeaIQAAKFARKRIEHKRPN---------------DRIGFLRLEeDGKTTLNILNPAGG-E-- 60 
7_pfamImport    1 NACSLTDSTA--EEHVLalvEHAADEARDRISRLVPG---------------GKMGYLKKNgDGSLLYSVVNTAGL-DAD 62 
XP_014041990  135 NACSLTDSTA--EEHVLalvEHAADEAHDRINRYMPN---------------SKMGYLRKEpDGNLLYTVVNQLNP-EAK 196 Atlantic salmon
XP_006009862  282 NACSLTDSTA--EEHVLalvEHAADEARDRINRYFPN---------------SKVGYLKKEgDGPLLFTVVNPSDP-EIE 343 coelacanth
EGT38831      355 -SEhQRRLTIGDIVGPLEE---GTAG-MLQLQEHR----LFSQAPVNYLNYGPFSSFAPTYDSTWATMTKEDTDLFLRTY 425 Caenorhabditis...
PAV59814      361 -----QGLKLGDLVGKLDE---GNPG-LLTLSDNSgfrfANQAMPITYLTYGTFSSFAPQYDSTWATLTKHESDLLLRTY 431 Diploscapter p...
VDN50871      373 ----RTSVTLGDLIGKLDE---GTPG-LCTPADHK----IPPQMPISFLSYGPFSSFAPQFDSTWANLCERDSRLLLSTY 440 Guinea worm
3_pfamImport   72 ----EKVFTIGDLVGKLDE---GNPG-IFAPVETK----SSAQVPISFLSYDPFSSFAPQFDSTWATLCERDSRLLLSTY 139
ESN92554      345 s-EkERVVDLGGVVGRLVA---GQSH-VNLPKDDI----RNKINPVTYLSYGAFSSYAPVYDSSNANVDKETTNLLLATY 415 Helobdella rob...
EDV29788      512 eIIaDKKVNLESLKGPIVS---TSNQsLNDLKSMQ----VKQIKPVEYLRYGNFSSFAPIYDTTASNLSKDDSDLILSAY 584 Trichoplax adh...
11_pfamImport  61 --KkHREVDLGSLTSRLVT---GIDV-MPEAKEDK----RNKVTPLTYLSYGPFGSFAPTFDSRIANLTQDESDLLMSAY 130
7_pfamImport   63 --GaCPPPTPSCLLTGPIPdlhALVT-C-SWGMAH----RPRVTFLS----SASTALSTHNNSVFGDLKADEVELLYSAY 130
XP_014041990  197 e-EeTHPVDLSSLSNKLLP---GLTT-L-GFKDDR----RHKVTFLS----STYNTQTLQNNSIYPDLLPDEMDLLYSAY 262 Atlantic salmon
XP_006009862  344 e-DeTISVDLSSLSSKFLP---GFTT-L-GFKDDR----RNRVTYLS----SAYTAQSLQNNTVFPNLKADEMELLYSAY 409 coelacanth
EGT38831      426 GDKTNAQSASSMRSFVENC-PEFLEVVDKKLNSLTDDEHSRTVKELEKPDRI 476 Caenorhabditis brenneri
PAV59814      432 GDRVTVSDVVAMRNLVSDAgEHMVKVVDDLLDFLTDGEHNRTQKCLSKQD-P 482 Diploscapter pachys
VDN50871      441 ADKENAANAISLRHMVEDAgEHMIKIVDDLLDTLTDGEHSKTISALEKKEQM 492 Guinea worm
3_pfamImport  140 GNRENVTNAISLRQMVENAgDHMIKIVDDILDTLTDGEHRRTISALETEKVT 191
ESN92554      416 ADETGVQYAKSLKEFVSGCgEYATMMVDNLLDVLTNGEHMKTEAILKEKELL 467 Helobdella robusta
EDV29788      585 GNSTALNYSRSLQRFVRNCsSYMTDFVDDILNSMTDGEHNKVIKRFKLKENE 636 Trichoplax adhaerens
11_pfamImport 131 GGDTGFLFAQSLQEYVSGCdASMMTMVDDLLDSVTHGEHRKTIKTIEDKRNK 182
7_pfamImport  131 GDETGVQCALSLQEFVKDAgSYSKKLVDDLLDQITGGDHSRMLFRLRQRRSV 182
XP_014041990  263 GDETGVQCALSIQEFVKGCgNVTKRLVDGLLDKMTAGDHSKAVYQIRQKRNM 314 Atlantic salmon
XP_006009862  410 GDETGVQCALSLQEFVQGCgGYTKKLVDDLLDQITGGDHSKAIYQIKQKRNI 461 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap