Conserved Protein Domain Family
TAFA

?
pfam12020: TAFA 
TAFA family
This family of secreted proteins are brain specific and thought to be chemokines. These proteins are found in vertebrates. Proteins in this family are typically between 94 to 133 amino acids in length and contain a number of conserved cysteines.
Statistics
?
PSSM-Id: 403292
View PSSM: pfam12020
Aligned: 8 rows
Threshold Bit Score: 129.545
Threshold Setting Gi: 47214708
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004068898  43 GGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNKPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCS- 121 Japanese medaka
2_pfamImport   1 QDTCEVITTHRCCNQNQVEEHSQTVRCPCFSGQVAGTTRAKPSCVDGLIILQKWWCHMEPCLPGEDCKMLPDLSGWSCS- 79 
XP_008117527  38 VGTCEITALDRDMSHPKRMIARQTARCSCRRGQVAGTTKAKPACVDAQIIVNRQWCGMEPCDDGEQCTLLINRSGWSCTr 117 green anole
XP_020947018  42 AGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIRTKQWCDMLPCLEGEGCDLLINRSGWTCTq 121 pig
XP_016079922  50 TGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCS- 128 Miniopterus nat...
XP_004769866  40 QGACEVIAAHRCCNRNRIEERSQTVKCSCFSGQVAGTTRAKPSCVDASIVLRKWWCQMEPCLRGEECRVLPDLSGWSCS- 118 domestic ferret
XP_008102069 143 gGTCKVIAVRRCCNHNHIEERSQTIQCSCLPGKVAGTTRGKPSCVDTSIVTGKWWCDMEPCLDGEECKALPDNSGWMCS- 221 green anole
CAG01061       1 AGSCEIIRLDQDRSRPWRSPARQTARCACGPGQTAGTTRARPACVDVHIVWRRRWCDMTPCLDDEDCRLLVDQSGWSCRq 80  spotted green p...
XP_004068898 122 SGNKIKTTRI 131 Japanese medaka
2_pfamImport  80 SGHRVKTTKV 89 
XP_008117527 118 QLGRIKT--V 125 green anole
XP_020947018 122 PGGRIKTTTV 131 pig
XP_016079922 129 SGNKVKTTRv 138 Miniopterus natalensis
XP_004769866 119 GGHKVKTTKv 128 domestic ferret
XP_008102069 222 VGNRVKTTKI 231 green anole
CAG01061      81 PGGRVRTTTV 90  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap