Conserved Protein Domain Family
FAP206

?
pfam12018: FAP206 
Domain of unknown function
This domain of about 280 residues is found in eukaryotes. There are two conserved sequence motifs: GFC and GLL. This family is also known as UPF0704. This domain is found in FAP206, a protein associated with cilia and flagella. In the ciliate Tetrahymena, the cilium has radial spokes, each of which is a macromolecular complex essential for motility. A triplet of three radial spokes, RS1, RS2, and RS3, is repeated every 96 nm along the doublet microtubule. Each spoke has a distinct base that docks to the doublet and is linked to different inner dynein arms. Knockout of the FAP206 gene results in slow cell motility and the 96-nm repeats lack RS2 and dynein c. FAP206 is probably part of the front prong and docks RS2 and dynein c to the microtubule.
Statistics
?
PSSM-Id: 403290
View PSSM: pfam12018
Aligned: 45 rows
Threshold Bit Score: 163.196
Threshold Setting Gi: 74830390
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEY60522            239 IQESVAALAKLVRDEVRDANEICTQ-YTEVLLHVhhqlg---tgeeaHSAEPSPSLDEIARWQDELSNRRQFLSYLQSLE 314 Phytopht...
Q57VI3              215 aellmsSLREHIEKELEEAISACAR-YVAVLRSPst---------pvEGSMREAICAEYHRQLQLLLNIRMAKQQLDTLN 284 Trypanos...
EDW02429            219 LEMAQSNTNAGFNAALERLKNLCDRcQTAVSDQLqfn-------ckeTQLLYRVPLEQLHRINQFTVTFYMLQRCLTALK 291 Drosophi...
XP_002059457        219 LQMAQSNTSAAFDAVLERLKDLSGKcQAAISEQLqfn-------ckeTTLYYRVPLEQLQRINQFTVTFNSLMRCLLELQ 291 Drosophi...
XP_002004300        219 LQMAQANTNAAFDAALERLKELSSRcQTAISEQLqfd-------ckeTTLYYGVALAQLDRINQFTITFNMLMRCLVALQ 291 Drosophi...
WGS:AAQB:GK21484-PA 218 LEMAQTNTEEAFHTALKQASQMRSFcQMAVEENIkid-------andMTLSYRVPLERLQRLNQFSLMYAMFYRCLNTLH 290 Drosophi...
WGS:AAPP:GF12186-PA 217 LEMAQKNTETAFAASMEKANGVRNIcQALLEELVtid-------smaETISYKVPLEHMDRLNQFSLTYCMLHRCLTTLN 289 Drosophi...
ACH92311            217 LEMAQKNTEAAFAASMGRAVKMQSTcQAALDDLInid-------hkdETLTYRVPLEHLDRLNQFAATYFMLHRCLTTLN 289 fruit fly
CDS39435            151 aEEGVRTTVETLDKQLKEVETYASL-FTSLYLKLaavdvntetqanvSAIEAKKMGISRSLLKAATINARQLAVYLRLIR 229 Echinoco...
XP_029345808        223 LRDSFKKVMMTTSWILQ-----CYKvYTEILAPIfv----------iRINFATVTIKKLNDYKTVLVFYLQYQKNLEIIK 287 pea aphid
EEY60522            315 EDIAFSHEKVGTRLQMFQADMSALQNLVGART----------SLPKSHVYPLF----EAVSHSWAELHQEHELLQ---AR 377 Phytopht...
Q57VI3              285 NQI------FGELLPSYEAALEAVKDVLGTRSmrsdgvslrkNVSKATVYPKF----IELAEVYEEAQRSFQSFEdikAL 354 Trypanos...
EDW02429            292 RSYEHTAYLVSVETGRYECVVAKINDTLSMRT----------SIQSELIFPHF----VYLSKVWSNLNHYFNHIV---EL 354 Drosophi...
XP_002059457        292 RSYEHTAYMVSVESGRYNCVIAKINDTLYMRS----------AIDSELIFPHF----VYLSKVWGNLNHYFNHIV---EL 354 Drosophi...
XP_002004300        292 SSYEHTTYLLSVETGRYDCVVAKINATLAMRT----------SIESELIFPHF----VYLAKVWANLNHYFNHIV---EL 354 Drosophi...
WGS:AAQB:GK21484-PA 291 LSYENTKYLVNVEQKRYQCVIAKINDTLSMRT----------AIESELIFPHF----VYLSQVWTNLNNFLNHIV---EL 353 Drosophi...
WGS:AAPP:GF12186-PA 290 SNYQTTAYLIEVELKRYNCVVAKINETLSMRT----------AIESELIFPHF----VYIAQVWGNLNNFLHHIV---EL 352 Drosophi...
ACH92311            290 EHYQKTVYLIEVEHKRYQCVICKIDDTLSMRT----------AIDSELIFPHF----VYLSQVWGNLNNYLNHIV---EL 352 fruit fly
CDS39435            230 RDLVNLESGHREDKEKLVLVLGEILNCLRANQ----------N----TLHPSFqkhlLELSRLWMKFKENVTFIA---ML 292 Echinoco...
XP_029345808        288 NDLNKLKIELPALLIKFNIILKEIKQ-LKNTN----------DFGEDTICPEF----NNVTIIWSEIRGIMNHLS---IT 349 pea aphid
EEY60522            378 ARALRSLLRFKstftrtlssespivrqarrggsIPPEDLFSHVETFPVEsQLAvdgktrsfglegedldgdeDNSNPSEE 457 Phytopht...
Q57VI3              355 MTLSLSLGKVS-----------------------NSSLPPTLLQEAINLeKEDgpadrcs------tearfeSIVTASLP 405 Trypanos...
EDW02429            355 NKLREQLEQQVtkemthrakdt-itqiqdlakrRKDWFECSFFERMDALkKYQt-------------------------- 407 Drosophi...
XP_002059457        355 NRLREQLECQVpkemeqrakdt-imeiqdlskhIKEMRECSFNERMELLkKYQt-------------------------- 407 Drosophi...
XP_002004300        355 NKLRERVEAQItsgmvqrsket-iaeiqelakrHSEMRKCSFNQRMDTLkKFQt-------------------------- 407 Drosophi...
WGS:AAQB:GK21484-PA 354 NKLREHLESLIpmdikslaest-vaeilairqrIKSDSVVSFDERMAALkMHQt-------------------------- 406 Drosophi...
WGS:AAPP:GF12186-PA 353 NKLREQLEALVvddlvtmtknt-iaelqalnkrIKTPKVVTFDERMNAVkGLKt-------------------------- 405 Drosophi...
ACH92311            353 NKLREQVEALVvddlmtltkat-iaelqalhkrIKKPKVCSFEERMDAVkELQt-------------------------- 405 fruit fly
CDS39435            293 SNLLNSLQQFSfrr----------------yvlLEASRLLNLIHEAEVV-CDE-------------------MRKKATTR 336 Echinoco...
XP_029345808        350 CNLILTMKQLTyeinniseei--nnksimdtilTDTEELYTIFETYPLHpMCE--------------------------- 400 pea aphid
EEY60522            458 E---GSGfpiRMPVES-TPEFMQL-PLD----YQGFCPWTVVERGGLLL--------PGDPSLGVVQYRN----AYHVFV 516 Phytopht...
Q57VI3              406 TkldRVFy---------ARDAETLrARSavcaLNGMCPVTLLE-DGLCVegrvgsrdPAFPGFVMRSEVDnervEWYAFQ 475 Trypanos...
EDW02429            408 -----------------DGNFCSLaKAD----IKEFCGLTLAVTNGLLL--------PAKVQRKLCMNVD----IKFGFQ 454 Drosophi...
XP_002059457        408 -----------------DGNFCSLaEAD----IKEFCGLTLAVTNGLLL--------PAKVLRKLCMNLD----IKFGFQ 454 Drosophi...
XP_002004300        408 -----------------DGNFCSLaQAD----IQEFCALAMAVTNGLLL--------PAKVVRKLCMNVD----IKFGFQ 454 Drosophi...
WGS:AAQB:GK21484-PA 407 -----------------DGNFCNLaRAD----INEFCALTLTITNGLIL--------PAHVQRKLCMNVN----ISFGFR 453 Drosophi...
WGS:AAPP:GF12186-PA 406 -----------------DGNFCNLaKAD----IKEFCGLFMTMTNGLLM--------PAKVIRKLCSNMD----ITFGFR 452 Drosophi...
ACH92311            406 -----------------DGNFCKLnKAD----IKEFCSLAMTITNGLLM--------PAQVTRKLCSNVD----ITFGFR 452 fruit fly
CDS39435            337 VkpkSEDrsqWAFPTP----GSEV-KVD----LNGFCAWSIVRYQGLPI--------PCTPWIGVYVFEG----KKYGFS 395 Echinoco...
XP_029345808        401 ----------WHPPTTsTDDTRNL-FAD------GYCVVMIVETDGTLI--------KHDKSLGVIQYSD----EWFGFA 451 pea aphid
EEY60522            517 NERALGEFMIHPRRYVQGVLRRAGRQPALIYLLRLQESFP 556 Phytophthora infestans T30-4
Q57VI3              476 TASKLLRFAASSQRFVDHAKTLVKSNMVMVGLFGLVdllp 515 Trypanosoma brucei
EDW02429            455 DETYARIGELWFERFITALRQAIFNSANLALLFKLDDALI 494 Drosophila grimshawi
XP_002059457        455 DETYARIGELWFERFIIAFRQAIFNSANLALLFNLDHALi 494 Drosophila virilis
XP_002004300        455 DETYARIGELWFERFITALRQSIFNNANLVLLFQLDHili 494 Drosophila mojavensis
WGS:AAQB:GK21484-PA 454 DHRFARYAELRFEQFIEAFRKVIFQNANLALLFHLDEELl 493 Drosophila willistoni
WGS:AAPP:GF12186-PA 453 DPQFARFAELRFEHFIVAFRSAVFNSANLALLFKLDDELI 492 Drosophila ananassae
ACH92311            453 DPRYARFAELRFEPFIAAFRKVVFNNANLALLFKLDDALI 492 fruit fly
CDS39435            396 SVEAAMEFGSAPEKFVAELNEVVRNNPELIDLLSMASTFQ 435 Echinococcus multilocularis
XP_029345808        452 SIQAALHFGTKPTYYLYHFLNLMRSKTHLLSFFHLYEQMA 491 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap