3K8P


Conserved Protein Domain Family
Dsl1_C

?
pfam11989: Dsl1_C 
Click on image for an interactive view with Cn3D
Retrograde transport protein Dsl1 C terminal
Dsl1 is a peripheral membrane protein required for transport between the Golgi and the endoplasmic reticulum. It is localized to the ER membrane, and in vitro it specifically binds to coatomer, the major component of the protein coat of COPI vesicles. Binding sites for coatomer are found on a disorganized region between the C and N termini of Dsl1. The C terminal domain is involved in binding to the Sec39 subunit of the Dsl1p complex. The N terminal complexes with another subunit of the Dsl1p complex called Tip20 which forms heterodimers by pairing the N termini of each protein.
Statistics
?
PSSM-Id: 371836
View PSSM: pfam11989
Aligned: 5 rows
Threshold Bit Score: 289.333
Threshold Setting Gi: 266618812
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K8P_C   167 LLQLXELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKL---EDNTILVALIRY 243 Kluyveromyces lactis
Q6FNZ0   551 MKRLQELIYNYMETNLQNTKKISKRILSSQLQQFQRNENNPSWNDTLDNFLPFLEEELANITTHItqeDSFRYITRLFSF 630 [Candida] glabrata
EDO19082 553 LDRLNELNYRLMENQIALKEKYVNSIIQNSLGNLERDEKDIRWRSQIKDLVPFIQCDIINPLISIgnpDSEKFILKFLNF 632 Vanderwaltozyma pol...
Q752C3   572 LYQLSELTARFTENNIATMRKAVFNMLQEQLNNLKANELSPNWDVTRNSLLPFIHDEVQPAFERL---SDQSVLLNFLKF 648 Eremothecium gossypii
P53847   560 LYRIKELTRNLLETKLNMKYRIVCQLIRHQLTEFRENERNPSWDATIEKLLPYILKEIVRPLQKIrgeEGSRYLLSFLNF 639 Saccharomyces cerev...
3K8P_C   244 IVHDLVIDNILHWRVISEKSSENLSEFIXLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEXFYEGEFFLFE 323 Kluyveromyces lactis
Q6FNZ0   631 IFEDVIIQNILSWDIISEKNSENISELLKLIITSTQIDSLNTYPKYRELYERVNIVAKLLPLHLKEIMEMFYNGDFYLFA 710 [Candida] glabrata
EDO19082 633 LFNNCITSNILNWKIISEKNSNNLSEFISLVLNASEVPSIETSPKYREIREKFIIIGKLLPLHLKDIMQMFYDGDFYLFS 712 Vanderwaltozyma pol...
Q752C3   649 LYNDCLVNEILQWNIISEKNSENLSELIHMIYNGTKFSALQDNNDYKHARTKLAIIALILKAHLKDIMDMFYNGDFFLFS 728 Eremothecium gossypii
P53847   640 LYNDCVTKEILKWQIISEVNSENLGELVSLLVNNTDIQLLAKEPSYKKMREKFATMGKFLPLHLKEIMEMFYNGDFYLFA 719 Saccharomyces cerev...
3K8P_C   324 TDEIVQWIILLFADTPTRRDCIDEIRRVREEATD 357 Kluyveromyces lactis
Q6FNZ0   711 TEEIITWIKLLFAETPLRKDAIDDIYEIRNTPTE 744 [Candida] glabrata
EDO19082 713 TEEIVQWIVLLFADTPLRRNAIDDINEIRKETLD 746 Vanderwaltozyma polyspora DSM 70294
Q752C3   729 TEEIIQWILLLFADTHMRRDCIYEVRTIRQESEE 762 Eremothecium gossypii
P53847   720 TDELIQWIELLFADTPLRRNAIDDIYEIRGTALD 753 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap