Conserved Protein Domain Family
DUF3483

?
pfam11982: DUF3483 
Domain of unknown function (DUF3483)
This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 230 amino acids in length. This domain is found associated with pfam02754.
Statistics
?
PSSM-Id: 403261
View PSSM: pfam11982
Aligned: 20 rows
Threshold Bit Score: 204.102
Threshold Setting Gi: 500475835
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q63MU7          5 ILITALLWLSVAGLAFAVAKRSAYWRLGRATTpgaFGLA-NLLAIPKRYFVDLHHVVARDPYIAKTHVATAGGALAALAL 83  Burkholderia p...
CBS89068        8 TVVLAVLVIGAALAAWQSRR----WLAGRPAA---VGVVaGLRALPGRYLVDVHHVVGRTPFNARFHALAAGGFLAA-VL 79  Azospirillum l...
Q0BW32          5 TPLLLVIWFLVLLVVVQALRIALRWRVGQKTH---VDWVrGLIAMPRRYLVDVHHVVERRPENARMHKLVAGGLLAGSVL 81  Granulibacter ...
WP_011941917    3 gLFVLLAWLLLAGVVAQGLRLAASWRRGGAAP---VDWArGLAALPRRYLVDVHGVVARRAAAARMHQAIAGGLLGGTAL 79  Acidiphilium c...
WP_013167800    6 lsLSLVILALALIAAAMMVRRARLWRIGKPAT---IDWVaGLLALPKRYLVDVHHVVGRDPYAARMHALAAGGLLGGSAL 82  Starkeya novella
nioo:CFU_3102  16 HIITVLFWLSAAGLSVGLARRAALWRAGREAS---VSWL-GLLAIPKRYFVDLHHVVARDPYIARTHVATAGGAIAAMAL 91  Collimonas fun...
Q13NF6          5 FVITVLLWLSVAGLAFALVKRSAYWREGRATAagaYGWT-NLLAIPKRYFVDLHHVVARDPYIAKTHVATAGGAILAMAL 83  Paraburkholder...
jgi:M301_1292   5 HLITLLFWLATATLLIGLWRRSQLWRQGQSAD---FSWI-NLLAIPKRYFVDLHHVVSREPFIARTHVATAGGAVAALIL 80  Methylotenera ...
CCB65086        5 pVITVLFWVSVVTLALGITRRALLWRAGQPAT---VAWS-GLFAVPRRYFVDLHHVVAREPYIAHTHVATAGGAVLAIGL 80  Hyphomicrobium...
jgi:Veis_4054   4 QLVRILFWLALLTLAWGLARRALLWRTGRGAD---VDLR-GLLQIPKRYLVDLHDVVAREPLVARAHVGAAGGAVLALAL 79  Verminephrobac...
Q63MU7         84 VFVNYGLAI-----YSPWLDRLILLAAL-AMLVGVVFVWRRRHa-kAVPARLSRGPWNTLPWLLGAFALGLVLFMLVPAA 156 Burkholderia p...
CBS89068       80 LLVAMAVGV-----AGWSVVWLLLAVVLaAMLAGSLMVWHRRRv--VRPRELSQGRFARLPVSLLGFSGSLLAVSLDQAL 152 Azospirillum l...
Q0BW32         82 TLLSTLLPVlhrggMVASLFWIVTAAFYaFGLSGARHVAARRSp--TTPPHLSAGRFLTLPLWLGLYLTGGLIAAIGAAL 159 Granulibacter ...
WP_011941917   80 VLLGIIPAL-----RGAEMLWLLAALGFgFAIFGARLVAQRRQp--ARPASLSGGAFQGLARDLAAYAAGGFLASLGILL 152 Acidiphilium c...
WP_013167800   83 ALLALIPPL-----GASRLFWAAIALAFaTAFIGGFMVGRRRIp--SKPTRLSGGRFQRLPFFLAGYSLGALLVALDAAL 155 Starkeya novella
nioo:CFU_3102  92 VAVNYGLML-----YASALNTAIGLFAL-VMLVGVLFVWHRRR---APPARLSRGAWMRLPWVLAAFAIGLLALGLVPLQ 162 Collimonas fun...
Q13NF6         84 VFVNYGLAI-----YSPWLDRLIFLAAL-VMLVGAVFVWRRRHgakAVPARLSRGPWDHLPLLLGSFALGLVLFIALPAS 157 Paraburkholder...
jgi:M301_1292  81 VAINYGLML-----YWNALNWAILIATA-IMLVGVFFVWLRRR---NAPSRLSRGAWSRLPYSLTAFAIGLLVISL-PVS 150 Methylotenera ...
CCB65086       81 VAINYGLGI-----YSRLLDWGIVLGAA-VMLAGVYCVWQRRR---NPPSRLSRGAWDRLPFTLAAFALGLLIAVAVPPG 151 Hyphomicrobium...
jgi:Veis_4054  80 VALNYGLGL-----YWRSLDALLLLAGL-VLLAGAATMAWRRR---NPPARLSRGAWQRLPHSLLLFALAVALTGAVACT 150 Verminephrobac...
Q63MU7        157 ------AMSGAFALLCAALIGAGAFAMTVGAAKGGPMKHAIAGLLHLAFHPRQERFAatrdaytgdggATPPTALKPSDV 230 Burkholderia p...
CBS89068      153 g----gVMPEALALVLVAIAGLAMADLVWGV-WKGPLKHAVHGALHLAFHPRPARFhd---------gKGRDTGLKPLPL 218 Azospirillum l...
Q0BW32        160 hgmlpdVLPHAAGAAGAVMTLTGGLALVAHLP-NGPMRHAVAGSLHLAAHPRPGRFE-----------GGRDTALLALDL 227 Granulibacter ...
WP_011941917  153 -------GLWLPALAGIGLAAWGGARLVAGIA-TGPMRHALAGAVHLAAHPRPERFA-----------GAAASGLLPaqn 213 Acidiphilium c...
WP_013167800  156 g-----GAIWPLAWLGLWLAAAGGFGLVLQID-RGPMRHAFAGAAHLVAHPRPGRFE-----------GQLATALAPLDL 218 Starkeya novella
nioo:CFU_3102 163 ------LMSGLSALVTVLLLGLGAWTLTVGATRGGPMKHALAGLLHLAFHPRQERFRqd-------gkGTPTTALKPLQL 229 Collimonas fun...
Q13NF6        158 ------AMSGALAVIVALLIAAGAFAMTFGAARGGPMKHALAGLLHLAFHPRQERFAerh-----dndVVPPTALKAPLL 226 Paraburkholder...
jgi:M301_1292 151 ------VLAGSVAVFALILLMAGSAELALGIGLGGPMKHAIAGLLHLAFHPRQQRFR-----------GELSTALKPIAL 213 Methylotenera ...
CCB65086      152 ------MLSAAIATLAIFFLLIGSAELVLGIGFAEPMKHAVAGLLHLAFHPRPERFS-----------GVRSTALKPLHL 214 Hyphomicrobium...
jgi:Veis_4054 151 g----tALAPWLAALISLAFAAGAAELALGIGLGGPMKHAVAGLLHLGLHPRPERFGe----------RRFATALRPLRL 216 Verminephrobac...
Q63MU7        231 ERD 233 Burkholderia pseudomallei
CBS89068      219 Apq 221 Azospirillum lipoferum 4B
Q0BW32        228 EAG 230 Granulibacter bethesdensis CGDNIH1
WP_011941917  214 fgv 216 Acidiphilium cryptum
WP_013167800  219 DTP 221 Starkeya novella
nioo:CFU_3102 230 EQG 232 Collimonas fungivorans Ter331
Q13NF6        227 DAK 229 Paraburkholderia xenovorans LB400
jgi:M301_1292 214 EAi 216 Methylotenera versatilis 301
CCB65086      215 DER 217 Hyphomicrobium sp. MC1
jgi:Veis_4054 217 NAD 219 Verminephrobacter eiseniae EF01-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap