Conserved Protein Domain Family
DUF3481

?
pfam11980: DUF3481 
C-terminal domain of neuropilin glycoprotein
This domain is found in eukaryotes at the C-terminus of neuropilins. It represents the transmembrane region of these transmembrane glycoproteins, that are predominantly co-receptors for another class of proteins known as semaphorins. The domain is found associated with pfam00754, pfam00431, pfam00629.
Statistics
?
PSSM-Id: 403259
View PSSM: pfam11980
Aligned: 4 rows
Threshold Bit Score: 151.563
Threshold Setting Gi: 704283312
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_024135818 865 GKPSGQSNMLETLDPILITIIAMSALGVFLGAIC-GVVLYCACSQGsmTDRNLSALENYNFELVDGVKLKKDKMNGQTnN 943  Indian medaka
XP_022535036 827 RFGRRGGSMLKTLDPILITIIVMSAVGVLLGAVC-GVVLYCACSQN--PDRNLSALENYNFELVDGIKLKKEKVNAQK-S 902  Mexican tetra
XP_014352765 847 SHAESPGSVLKTLDPILITIIAMSALGVLLGAIC-GVVLYCACWHNgmAERNLSALENYNFELVDGVKLKKEKLNSQN-S 924  coelacanth
XP_010157114 169 PKLDKEKSWLYTLDPILVTIIAMSSLGVLLGAICaGLLLYCTCSYAglSSRSSTTLENYNFELYDGIK-HKVKMNHQK-C 246  sunbittern
XP_024135818 944 YSEA 947  Indian medaka
XP_022535036 903 YSEA 906  Mexican tetra
XP_014352765 925 YSEA 928  coelacanth
XP_010157114 247 CSEA 250  sunbittern
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap