Conserved Protein Domain Family
RNase_Zc3h12a

?
pfam11977: RNase_Zc3h12a 
Zc3h12a-like Ribonuclease NYN domain
This domain is found in the Zc3h12a protein which has shown to be a ribonuclease that controls the stability of a set of inflammatory genes. It has been suggested that this domain belongs to the PIN domain superfamily. This domain has also been identified as part of the NYN domain family.
Statistics
?
PSSM-Id: 403256
View PSSM: pfam11977
Aligned: 20 rows
Threshold Bit Score: 116.269
Threshold Setting Gi: 156566530
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDO30380       67 SLRPIVIDGSNVA------------MSHGk------------QQVFSCRGIGIAVDwFIKRGHREITVFVPMWRKEAsrp 122 starlet sea an...
XP_002633991   50 YLRPICIDGTDVSnklnliirkdmeLFPMd------------KSIFNMRAISMTLWyFISRGHSATVFLPTNLRDFA--- 114 Caenorhabditis...
Q9TYQ2         36 LLRPVFMNAVEVGy----------sYAHCd-----------rDKKLNVRGVTIALWhFICRGHQAIALLPYCFKNYA--- 91  Caenorhabditis...
Q4JSB5         60 ERRTVLLDACNVS------------HYQNr------------LPRFSVERLAKALEyFVENGHEVYAVFPRFHl-----y 110 African malari...
Q5TX22        399 MKRMVIIDGNNVA------------YGHLn------------GKMFSVKGLELCINyFKKLGF-EVTAVVPQFKLKR--- 450 Anopheles gamb...
Q17KS7        330 KKRFVVIDGNNVA------------FAHTh------------GQAFSVKGLDICIQyFKKLGH-EVKAVVPQFRLKK--- 381 yellow fever m...
jgi:Igni_0753  43 PQDVAVVDASNVV-------------MHGpk----------vGKKGRIENLLVVINaLRERGFEVYAIADASLR------ 93  Ignicoccus hos...
XP_002633081   67 VRRTIVIDGANVM--------------HCgsphtdhrkgaiqQNIPDVAALFSLIRyFVVRDFDVLTVISRKYa-----k 127 Caenorhabditis...
Q23342         69 VARTIVIDGANVM--------------HCgsgypdrrensksSHIPDVMPLLSLIRfFVVRDFEVFVVISRKYa-----k 129 Caenorhabditis...
CAP24743      249 NLRSVVVDGSNIA------------MLHGr------------KEVFSCAGLRECLHyFLERGHPEVLIFIPQYRREQprs 304 Caenorhabditis...
EDO30380      123 ETPIIDQEVLMRLEKDGILTWTPSRRIDGRRITCYDDRFIVRLAAENEGVIVSNDNYRDLLNES-SDWKKAIEQRLLMFA 201 starlet sea an...
XP_002633991  115 -QKCSDPHELSLLAKLELIVFDESNSQHPSSTV-LLSKTIATWAEDNDGCIVGSRKKYALLGQKyTELIDRVTNSLISPT 192 Caenorhabditis...
Q9TYQ2         92 -EKSSRYSELMMLYRLNLIEFTPGYGSEKYTEV---NRIMVNRAYETGGCLVARSQMQGITDNK-SHLIDVVEQRLLMPT 166 Caenorhabditis...
Q4JSB5        111 TGQWDNVDRLQGLYRKSYIVPTPCKEFPCAKSQVYDDRILMAIAAQYQCAVVSNDRFRDVASEH-PDWAFVAANRRLPFD 189 African malari...
Q5TX22        451 -YQSTDQALLEQMHRNGDVTLAPCKSLPGQCSSSYDDRLILSIAEQFDGVIISNDNFRDLLDIS-PEWRRIIETRVVGYS 528 Anopheles gamb...
Q17KS7        382 -EKSTDQRLLEELYKKGDILLAPSKNLPGQKSSSYDDRLIISVAEKFDGVIISNDNFRDLMEEN-DSWKKIIETRVAGYT 459 yellow fever m...
jgi:Igni_0753  94 -HKVDKPEVLERLIAKGVVLQAPASTPA--------DYFILSVADREYGIVVSNDVFKEWRTL--FPWIKDKY-RLVRYM 161 Ignicoccus hos...
XP_002633081  128 PGATTFKRAIDELVENNLCIVIPSSYLD--------DTVALEFAAQLNGVVLTSDLYRDHSNMN-NRSRRVVEKHRLNIG 198 Caenorhabditis...
Q23342        130 QDATNFKSAIDRLIENHLCVVVPSSNLD--------DSVALQFASQINGVVITTDQYRDHASDS-LRFNTIVRENRLGIK 200 Caenorhabditis...
CAP24743      305 DSPITDQHILLEIERHII--YTPSRNVNGRRVVCHDDRYILRTAELKDAVIVSNDEYRDLTREN-PAWKKIVEERLLMFT 381 Caenorhabditis...
EDO30380      202 FVNDRFM-PPEDPGGRY--GLPLKD 223 starlet sea anemone
XP_002633991  193 FTPDHEL--------RV--GDCVRL 207 Caenorhabditis briggsae
Q9TYQ2        167 FNGDDIMfPIDGPLGRN--GPSLEQ 189 Caenorhabditis elegans
Q4JSB5        190 W----------DSNGRL--AIYNTD 202 African malaria mosquito
Q5TX22        529 WVKDCFF-LPDDPYGRY--GPTLQQ 550 Anopheles gambiae str. PEST
Q17KS7        460 WVMDAFF-LPDDPYGRK--GPSLTD 481 yellow fever mosquito
jgi:Igni_0753 162 IVGKTAYfYPDVRPKKK--RKKVKE 184 Ignicoccus hospitalis KIN4/I
XP_002633081  199 WEI-----INDESRNMRlkNPEMDy 218 Caenorhabditis briggsae
Q23342        201 WENVKCK-------NTR--APNIEN 216 Caenorhabditis elegans
CAP24743      382 FVEDKFM-PPDDPSGRN--GPRIES 403 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap