Conserved Protein Domain Family
DUF3477

?
pfam11963: DUF3477 
Protein of unknown function (DUF3477)
This family of proteins is functionally uncharacterized. This protein is found in viruses. Proteins in this family are typically between 246 to 7162 amino acids in length. This protein is found associated with pfam08716, pfam01661, pfam05409, pfam08717, pfam01831, pfam08715, pfam08710.
Statistics
?
PSSM-Id: 152398
View PSSM: pfam11963
Aligned: 4 rows
Threshold Bit Score: 583.824
Threshold Setting Gi: 81992170
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q66WN6    1 MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRVNCSRLPALECCVQSAIIRDI 80   Murine hepatitis virus
Q80GN7    1 MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRVDCSRLPALECCVQSAIIRDI 80   Murine hepatitis virus
Q06BE1    1 MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREI 80   Bovine coronavirus ...
Q0ZJA3    1 MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDI 80   Human coronavirus HKU1
Q66WN6   81 FVDEDPQKVEASTMMALQFGSAVLVKPSKRLSIQAWTNLGVLPKTAAMGLFKRVCLCNTRECSCDAHVAFHLFTVQPDGV 160  Murine hepatitis virus
Q80GN7   81 FVDEDPQKVEASTMMALQFGSAVLVKPSKRLSVQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGV 160  Murine hepatitis virus
Q06BE1   81 VMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCSPKGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGV 160  Bovine coronavirus ...
Q0ZJA3   81 FVHEDLHVVEVLTKTAVKSGTAILIKSPL-------HSLGGFPKGYVMGLFRSY--------KTKRYVVHHLSMTTST-T 144  Human coronavirus HKU1
Q66WN6  161 CLGNGRFIGWFVPVTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDAceEVHLNPKGKYSCKAYA 240  Murine hepatitis virus
Q80GN7  161 CLGNGRFIGWFVPVTAIPEYAKQWLQPWSILLRKGGNKGSVTSRHFRRAVTMPVYDFNATDV--VYADENQDDDADDPVV 238  Murine hepatitis virus
Q06BE1  161 CFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFE-HVYNFKVEDAydLVHDEPKGKFSKKAYA 239  Bovine coronavirus ...
Q0ZJA3  145 NFGE-DFFGWIVPFGFMPSYVHKWFQFCRLYIEE--------SDLIISNFKFDDYDFSVEAAyaEVHAEPKGKYSQKAYA 215  Human coronavirus HKU1
Q66WN6  241 LLKGYRGVKPILFVDQYGCDYTGCLAKgleDYG-DLTLSEMKELFPVWRDSLDSEVLVAwhVDRDPRAAMRlqtlATVRC 319  Murine hepatitis virus
Q80GN7  239 LVADTQEEDGVAKEQVDSADSEICVAH---TGGqEMTEPDVVGSQTPIASAEETEVGEA--CDREGIAEVK----ATVCA 309  Murine hepatitis virus
Q06BE1  240 LIRGYRGVKPLLYVDQYGCDYTGGLADgleAYA-DKTLQEMKALFPIWSQELPFDVTVAwhVVRDPRYVMRlqsaSTIRS 318  Bovine coronavirus ...
Q0ZJA3  216 LLRQYRGIKPVLFVDQYGCDYSGKLADclqAYG-HYSLQDMRQKQSVWLANCDFDIVVAwhVVRDSRFVMRlqtiATICG 294  Human coronavirus HKU1
Q66WN6  320 IDYVGQPteDVVDGDVVVREPAHLLAANAIVKRLPR 355  Murine hepatitis virus
Q80GN7  310 DALDACP--DQVEAFDIEKVEDSILSELQTELNAPA 343  Murine hepatitis virus
Q06BE1  319 VAYVANPteDLCDGSVVIKEPVHVYADDSIILRQHN 354  Bovine coronavirus isolate Alpaca
Q0ZJA3  295 IKYVAQPteDVVDGDVVIREPVHLLSADAIVLKLPS 330  Human coronavirus HKU1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap