Conserved Protein Domain Family
WASH_WAHD

?
pfam11945: WASH_WAHD 
WAHD domain of WASH complex
This domain forms part of the WASH-complex of domains and proteins that activates the Arp2/3 complex, see pfam04062. The Arp2/3 complex regulates endocytosis, sorting, and trafficking within the cell. The WAHD domain attaches to the FAM21 proteins via its N-terminal residues and to the microtubules via its C-terminal residues.
Statistics
?
PSSM-Id: 403229
View PSSM: pfam11945
Aligned: 11 rows
Threshold Bit Score: 308.58
Threshold Setting Gi: 586726773
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDV98214                       11 AYQVSIIPTDLQHEETIIRAAQSLDCLNKTINSIFGRIDARLARNGVHVQLINERVLRAQAKINALVGSKKSIKIYAPAR 90  Drosophila grimshawi...
XP_006004518                   11 VYSVPLIQPDLRREEAIHQITDALQYLQRVSDDIFSRVLERVESNRTRLQGVSDRITIAQARIKKIKGSRKATKVFSSAK 90  coelacanth...
A4IG59                         14 VYSVPLIQPDLRREEAVHQITDALQYLEMISTDIFTRVSESVEKNRAHLQSVTDRIKLAQARVQKIKGSKKATKVFSSAK 93  zebrafish...
B2RYF7                         14 VYAVPLIQPDLRREEAIQQVADALQYLQNISGDIFSRISQRVELSRRQLQAIGERVSLAQAKIEKIKGSKKAIKVFSSAK 93  Norway rat...
XP_025004586                   23 TYSVPLIQPDLRREEAVQQVADALQYLQKVSGDIFNRISQRVETSRAQLQAISERVTLAQAKIEKIKGSKKAIKVFSSAK 102 chicken...
Q28DN4                         11 AYSLPLILPDLRREEAIHQITDTLQHLQTVSNDIFSRILQRVETNRGQLQRINGRLSLAQAKIERLKGIKKAIKVFSSAK 90  tropical clawed frog...
XP_002113304                    5 KFAVPIITTDLRREESLRQTADVLQHVEKVCNDTFDHVVQRVEDVKKKLEAIENRTKVAKAKIDKIRTSTKATTILSANK 84  Trichoplax adhaerens...
WGS:AAGF:cds.TTHERM_00766470A  10 hNKITMSNTDMSQYEGLEKTLSNLSMLDETLSYVIQRFDNQQNQYKNKIQQYLDRIHICQKKIAALQEQKKAITFVSP-- 87  Tetrahymena thermophila SB210...
Q16PS7                          8 CYNIPTIDPDLRHEETILQAINAFEFLNEVIEDVFGKVNRRIESNRERLHKLNARIEKVNDQVAKLKETREAIVIYSPCR 87  yellow fever mosquito...
Q7PMJ3                          7 TYSVPIVKHDIRHEETILDAINAFEYLNQVVEDVFGKINARIERNRARLEAIDGRVEQVSASVRKLHETKQAIIIYSPSR 86  Anopheles gambiae str. PEST...
ETN65114                        3 TYSVPVIKHDMRHEETVLDAINALEYLNEVVNDVFGKINGRIERNRERLQALDARIEKAKDDVRRLHDAKEAIIIYSPSR 82  Anopheles darlingi...
EDV98214                       91 FPGtSTLNINISATFpqvvdhqkptsmetSTSSAAAVPAEFSQRRRHTNNL----------------------------- 141 Drosophila grimshawi...
XP_006004518                   91 YPA-PERLQEYSSIF--------------MGVEDAATLKRPRYKVQSKHRPl---------------------------- 127 coelacanth...
A4IG59                         94 YPA-PEKLQDYSSIF--------------TGAVDPASQKRPRIKVQSKLRPl---------------------------- 130 zebrafish...
B2RYF7                         94 YPA-PEHLQEYNSVF--------------TGALDPGLQRRPRYRIQSKHRPl---------------------------- 130 Norway rat...
XP_025004586                  103 YPA-PERLQEYCSIF--------------AGAEDPAKQKWPRHKIQSKHRMl---------------------------- 139 chicken...
Q28DN4                         91 YPA-PEHLQEYSSVF--------------AGAEDGWLAKKLRHKIQSKHRPl---------------------------- 127 tropical clawed frog...
XP_002113304                   85 YPV-ADIMTNYESLFa-------------SIDSELGELKRSHYRITNDIMPf---------------------------- 122 Trichoplax adhaerens...
WGS:AAGF:cds.TTHERM_00766470A  88 ----SSFVQKYKFTHenkksi---lqdykQKHNISKFETQFGYQLKNDPEQvgpiidnsrpddlyqilnisygkfksrek 160 Tetrahymena thermophila SB210...
Q16PS7                         88 YPG-ADLDTKVLPTFt-------------GANGILMREAEEVGNLREKSYv----------------------------- 124 yellow fever mosquito...
Q7PMJ3                         87 YPA-ADVDPTIEPTFt-------------PTNGIAL--AECHFRLRDKPYl----------------------------- 121 Anopheles gambiae str. PEST...
ETN65114                       83 YPA-SDMEATVEPTFt-------------ATNGIRM--PECSYRLKDKPYq----------------------------- 117 Anopheles darlingi...
EDV98214                      142 ----NDALEEQPSgaeldtvFFHVRGE-EQLETPLVVERqqtnrmaGLGTLPE-TKSVPTLMRFNTNEfayaggqdgned 215 Drosophila grimshawi...
XP_006004518                  128 ---eEKLLQEKLM-------YFPVYLN-TKHQEENEGEE-------GLGSLPRnVRSVSSLLLFNTNE------------ 177 coelacanth...
A4IG59                        131 ---dDKAQQEKLM-------YLPVCVN-TKKRSEDETEE-------GLGSLPRnVNSVSSLLLFNTTE------------ 180 zebrafish...
B2RYF7                        131 ---dERALQEKLK-------YFPVCVS-TKSEPEDEAEE-------GLGGLPSnISSISSLLLFNTTE------------ 180 Norway rat...
XP_025004586                  140 ---dEKSLQEKLK-------YFPVCVN-TKIHQEDDAEE-------GLGSLPRnISSLSSLLLFNTTE------------ 189 chicken...
Q28DN4                        128 ---dEQAVQEKLK-------YFPVCVN-TRGQDEESAEE-------GLGSLPRnISSVSSLLLFNTTE------------ 177 tropical clawed frog...
XP_002113304                  123 ---nEKLIDESPK-------IELPNARhRINMVEDQLDE-------GLGGLPTdLTSVSSLLLFNSQE------------ 173 Trichoplax adhaerens...
WGS:AAGF:cds.TTHERM_00766470A 161 npveNRKLPLKEK-------FF------------------------GVGTYPKkIKCAESLLVLNTNI------------ 197 Tetrahymena thermophila SB210...
Q16PS7                        125 ---pSHSYQEKIQ-------FYHVKSSsER-HRIYEFDEt-----rANQKGPReVQFLDSVLLFNSNQy----------- 177 yellow fever mosquito...
Q7PMJ3                        122 ---pSHSLQEKIQ-------FYHVKSPrES-ERIFPFESaparsgsGSLQGRGlGPFLDTLLLFSEPAy----------- 179 Anopheles gambiae str. PEST...
ETN65114                      118 ---pSHSLQEKIQ-------FYHVKTVrDGCERIFPFERstkahrlGNRE-RHqTAYLDELLLYGDGAy----------- 175 Anopheles darlingi...
EDV98214                      216 lNAWKR--TLPPQRSSHKRATPAVAARSSALLAPAPHSLSHGTIKLATPAGDLRYTPAALAAPAIDVPLDLP---DLPGI 290 Drosophila grimshawi...
XP_006004518                  178 -NLYKKyvLLDPLAGAVTKTHNTLETEKEEKPFDAPLSITKREQLERQTAENYFYVPDLGQVPEIDVPSYLP---DLPGI 253 coelacanth...
A4IG59                        181 -NLYKKyvFLDPLAGAVTKTHTTLETEKEDKPFDAPLSITKREQLERQTAENYFYVPDLGQVPEIDVPSYLP---DLPGI 256 zebrafish...
B2RYF7                        181 -NLYKKyvFLDPLAGAVTKTHTMLGTE-EEKLFDAPLSISKREQLEQPAPENYFYVPGLGQVPEIDVPSYLP---DLPGV 255 Norway rat...
XP_025004586                  190 -NLYKKyvFLDPLAGAVTKTHVALETETEEKLFDAPLSITERGQLDRQVAENYFYVPDLGQVPEIDVPSYLP---DLPGI 265 chicken...
Q28DN4                        178 -NLYKKyvFLDPLAGVVTRTNPALEGEDEEKLFDAPLSITKREQLERQTAENYFYVPDLGQVPEIDVPYSLP---DLPGV 253 tropical clawed frog...
XP_002113304                  174 -NPYKKyiTLDPLAGAVTKTRSTIEQE-ANALGDAPVTISQRQGMERKPMESYFYVPNLGDVPEFDVPSFLP---NLSGV 248 Trichoplax adhaerens...
WGS:AAGF:cds.TTHERM_00766470A 198 -NPYRKyqQIDNLIIDESKQQQRVKPDDTNQINLQVAPVGISNQLTAYQRSELTYVP---ETKKVDNAVSIPldfGLDGV 273 Tetrahymena thermophila SB210...
Q16PS7                        178 aEEYKG--AEDKSRGSGRKTT---GRIREERILSASSPIIRNRS--RKKGQDIFYTPVLNEAPKIDVPVDLP---DLPGI 247 yellow fever mosquito...
Q7PMJ3                        180 vQQYRG---QDWKRPVRKSSSHAVGGIREEKVLSSSSPIIRSRM--KKKSQDIFYTPSLNDAPKLDVPIDLP---DLPGI 251 Anopheles gambiae str. PEST...
ETN65114                      176 vREYKG---QDWKRSTLRKGSVHGNVIREERIMSTSSPMIRSKV--KKKTQDLFYTPSLSDAPKLDVPIDLP---DLPGI 247 Anopheles darlingi...
EDV98214                      291 ANDLQYEpVEEQTPIAPSHQFVD-LPDLPGLNEN-EPEPQPEDEK 333 Drosophila grimshawi
XP_006004518                  254 AADLMYS-ADLGPGIAPSVPGSN-MPELPTFYTE-PTYVNGQDQQ 295 coelacanth
A4IG59                        257 ADDLMYS-ADLGPGFAPSVPASNsIPELPSFGTD-HDESSGSDSQ 299 zebrafish
B2RYF7                        256 ADDLMYS-ADLGPGIAPSAPGA--IPELPAFHTE-VAEPFQPERE 296 Norway rat
XP_025004586                  266 AADLMYS-ADLGPGIAPSAPSSA-IPELPTFSTE-SVEPSQADLQ 307 chicken
Q28DN4                        254 ADDLMYS-ADLGPGIAPSAPGVP-IPELPTFITEdITENSRTDSQ 296 tropical clawed frog
XP_002113304                  249 ADDVTFD-VDNEISIAPSAGFV--FPDLPTVETT-PVPTANGGTE 289 Trichoplax adhaerens
WGS:AAGF:cds.TTHERM_00766470A 274 AEDFDID-YGGQDLIQPSAWLIQ-NPTLPDPYAN--AQPSSQSQN 314 Tetrahymena thermophila SB210
Q16PS7                        248 VSNIQY--EGNNTLIAPSLQLAAiADQLPELGEL--SAMEAKETV 288 yellow fever mosquito
Q7PMJ3                        252 VSNINY--VGNSTLIAPSLQLAGiIEQLPSLEDL-TSAIDVADHH 293 Anopheles gambiae str. PEST
ETN65114                      248 VSNINY--VGSNTLIAPSLQLAGiIEQLPSLEDL-TSAIDVADHH 289 Anopheles darlingi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap