Conserved Protein Domain Family
DUF3440

?
pfam11922: DUF3440 
Domain of unknown function (DUF3440)
This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is typically between 53 to 190 amino acids in length. This domain is found associated with pfam01507. This domain has a conserved KND sequence motif.
Statistics
?
PSSM-Id: 403210
View PSSM: pfam11922
Aligned: 27 rows
Threshold Bit Score: 320.353
Threshold Setting Gi: 81621668
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y7H0        237 GLTVHDMRVASPFNDAATESLKLYRVIEPALWSKLVGRVNGANFTAIYGGTSAMAWKEIKLPKNHTWKSYLEFLLTTLPS 316 Listeria monoc...
Q189D8        241 GVAPRKMRVASPFNDSAKESLNLYRILDPDVWVKLVARVQGVNFTSIYGKTKAMGYRSVKLPYGHTWKSFTYFLLDTLPE 320 Clostridioides...
Q9A1M4        242 GLKPSQMRVASPFQDYAVDSLNLYRIIDQETWVKLLGRVQGVNFSNIYGRTKAMGYKSIALPKGHSWKSYTQFLLSTLPV 321 Streptococcus ...
CDC43709      241 GLKVSQMRVASPFNDYSKDSLNMYRVIDPAIWTKLVGRVQGANFACIYGRTKAMGYRNVTLPEGYTWKEFTQFLLSTLPP 320 Firmicutes bac...
CDC74575      240 GLNPDQMRVASPFNDYSKDSLNLYRVIDPEVWARLVGRVRGANFGAIYARTKAMGYRSVTLPEGHTWKSYTHFLLDTLPT 319 Firmicutes bac...
WP_022202519  242 GLKIDQMRVASPFNDYSKDALNLYRVIDPEIWTKLVGRVRGANFGAIYGKTKAMGYRSITLPEGHTWKSYTQFLLDTLPA 321 Clostridiales
WP_013757509  241 GLKPSQMRVASPFNEYAKDSLNLYRILEPQTWTKLVGRVHGANFAAVYGKTKALGYRNLTLPEGHTWKSYTQFLLSTLPV 320 Treponema bren...
jgi:Amuc_0783 239 GLTIGQMRVASPFNDCAQESLKLYKVIDPANWARMVGRVNGVNFTGLYGGTTAMGWKTIKLPPGHTWKSYYEFLLSTMNE 318 Akkermansia mu...
Q9CGF9        248 GVPFKSMRVANPFHQCGVSSLKLYQALEPETWGKLIGRVNGANFAAIYGGTIALGYRGVSLPKGHTWETYVDFLLKTLPE 327 Lactococcus la...
AEW85886      230 GVPIHSMRVASPFNDCATESLKLYKVIDPNNWGKLIGRVNGVNFAGLYGGTTAMGWNSITKPSHFTWKEYMYFLLDTLPE 309 Flavobacterium...
Q8Y7H0        317 YTRERYLKKFKTSITYWTEKGGALKVETVEELKNLEIQADFLGKpqnnRVYTNPM--EIVRFkEYPDDLK-IKEFASVPT 393 Listeria monoc...
Q189D8        321 NIRNSYIKKFSTSIEFWQNTGGGLSEIVIRELLRKGYKIELNGV----SNHTKDKksRVIFLdDIPDDTDdIKFTKDIPS 396 Clostridioides...
Q9A1M4        322 RLRNNYVRKFNKSIDFWHKTGGGLAEETINELIEKGYRIARNGI----SNYTSFKhsRVIFLdQIPDDTDdIVTTKDIPS 397 Streptococcus ...
CDC43709      321 RLRNNYEKKFSTSIQFWHETGGGLDDEAIHELQMKGYSVRRNGV----SNYTRNKksRVVFIgKIPDDTDdIKSTKDIPS 396 Firmicutes bac...
CDC74575      320 RLRDNYLEKFKTSIRFWHEVGGGLSEETIAELEERGYRIARNGV----SGYTQGLksRVIFLdPIPDNTDdIKTTKDVPS 395 Firmicutes bac...
WP_022202519  322 RLRNNYVKKFNTSIHFWRETGGGLPEETIRELVEKGYHIRRNGI----SNYTINKnsRIIFLgPIPDHTDdIKSTKDIPS 397 Clostridiales
WP_013757509  321 RLRHSYMEKFKTSIQFWHYTGGGLPEAAIEELFEKGYKIYKNGV----SNYTLDKktRVVFLqKIPDDTDdIRSTKDIPS 396 Treponema bren...
jgi:Amuc_0783 319 KTAEHYNNILERSKKYWM-KGGTVDPGTADEVLAAYPLATVTGK----SGRYVDR--DVIQFmGYPDDMP-VSNFRQVPS 390 Akkermansia mu...
Q9CGF9        328 DIREVYLKKFQSSLTYWTKNGGALPQKVVSELEETNLQFENLGTpknnRNYKQEY--ELVRFkKYPDDVP-IKNFRLVPS 404 Lactococcus la...
AEW85886      310 ETRENYLRKLKVSFDYWLENGGALPVDVANELPK-DLGFEDLGSpknnRNYTTDY--RVIKFkEYLDEID-IKNPNLLPT 385 Flavobacterium...
Q8Y7H0        394 YKRMCIAILKNDYTCKYMGFGQTKLELEK 422 Listeria monocytogenes
Q189D8        397 WKRMCYCILKNDHMCRFMGFGPTKEQRIr 425 Clostridioides difficile 630
Q9A1M4        398 WKRMCFCILKNDHICRTMGFGLTREQQKi 426 Streptococcus pyogenes serotype M1
CDC43709      397 WKRMCYCILKNDHTCRFMGFGITREQQHr 425 Firmicutes bacterium CAG:424
CDC74575      396 WKRMCCCILKNDHTCRSMGFGLNRQDKlr 424 Firmicutes bacterium CAG:272
WP_022202519  398 WKRMCYCILKNDHTCRFMGFGLTRQQQKR 426 Clostridiales
WP_013757509  397 WKRMCYCILKNDHLCRFMGFGLSRQEQNK 425 Treponema brennaborense
jgi:Amuc_0783 391 YKRMCICIMKNDYFCKYAGFGPTKGAIar 419 Akkermansia muciniphila ATCC BAA-835
Q9CGF9        405 YKRMCVTILKNDTSCQYMGFGQTKDELQK 433 Lactococcus lactis subsp. lactis
AEW85886      386 YKRMCIAIMKNDTSCKTLGFGQTKQELTR 414 Flavobacterium columnare ATCC 49512
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap