Conserved Protein Domain Family
DUF3435

?
pfam11917: DUF3435 
Protein of unknown function (DUF3435)
This family of proteins are functionally uncharacterized. This protein is found in eukaryotes. Proteins in this family are typically between 435 to 791 amino acids in length. This family is related to pfam00589 suggesting it may be an integrase enzyme.
Statistics
?
PSSM-Id: 371796
View PSSM: pfam11917
Aligned: 19 rows
Threshold Bit Score: 383.626
Threshold Setting Gi: 146324251
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5B7D4       209 IEDVAEFARVLLSTTEMTFQFGWLRIQLLLFCQLAAITGCRPGAMLN----------LRYRDLVLTLIRNPDG-GRPQLF 277 Aspergillus nid...
XP_001542227 210 LDDLVKVVETTVTTTKKKFGHGRQRILLCLFFQLAGFSANRPQALLN----------LCYRHIKITLLKDPDG-GPNNIL 278 Histoplasma cap...
XP_001536444 197 VDDLAEYLRVLLVTNEMEFLVGWLRVELILFCQIAGVTGNRPDALTQ----------LRYRDLELTLVRDPHS-SAPRLC 265 Histoplasma cap...
EDN02495     200 IEDVAEFAQVVLTTTEMTFVCGWQRIQMLLFLQLAAITASRPSAILH----------LRYRDVVLTLIRVPDG-GRPRLF 268 Histoplasma cap...
CAK45787     196 SEDVFELLKVLWTTATEP----WDPVQLALIILLAGITGQRPGALVS----------LKHADVAITLF--PTGrERPHMV 259 Aspergillus niger
Q0C8S6       210 SEDVFQLMKVLWTTGSET----WDPVQLALIVLLAGMTGHRPDALLH----------VRHADVAVTLF--PTGrERPHMV 273 Aspergillus ter...
Q2U9V3       140 YWNYWVLLRREKVGLSIPAITKDKMVGLSLILLLAGMSGHRPDALLS----------LKNANVQVALL--PTGrERPHMV 207 Aspergillus oryzae
EDN08847     161 VEDLLSVLHYHWCLDTAAVPHERYTVQLPLLMLMTAYTSSRPGALTEsgcvrgsndaLRYRDVVLRVIPNPEElERHVLV 240 Histoplasma cap...
XP_001544467 162 VEDLVAILHYHWCLDTASVTHERYTVQNPLLMLFIAYTSTRPGALIEsgclrgsndaLCYKDIVLRVIPNPDQpDRHVLV 241 Histoplasma cap...
EBA27228      39 IEDLLYSTYHLVAFCKVRFATVRCRQQLSTLRKMMTSTSARPGTLVLssgymrspdaLKWKDIELYMVKHPEDpNCQMLL 118 Aspergillus fum...
Q5B7D4       278 IYFTPEFTKTFLGEKEK----NT---------------FPIPEIIF---DPTLVLSPHVFLLGMLFRIQGFKNfsengLV 335 Aspergillus nid...
XP_001542227 279 IEFTIEFAKTFLGEKEE----TT---------------FIVPETIF---DPSLVLSPHVTLLGLLFADRAFAPld-geRV 335 Histoplasma cap...
XP_001536444 266 VGLTAHFTKTFLGMKDA----NT---------------FWLPEIIY---DPTLVLSPHVFLLGMLFYIQAFKS-----PG 318 Histoplasma cap...
EDN02495     269 IFLKPEFTKRFLGDKAP----NE---------------FKIPEIIF---DPTLVLSPHICLLTLLFHIGGFKSistsgPV 326 Histoplasma cap...
CAK45787     260 LEVKPRNTKGYRGKKKPwyvpNCctkcpnirfdrysleIGIPEVPS---EPCLLFCPKTLFLGLLIRKSAFRH-----LH 331 Aspergillus niger
Q0C8S6       274 LEVKPNRTKRYRGRKKQ----NPt--------------LGIPEVPS---EPCLLLCPKTLLLALLLRKSAFLH-----LH 327 Aspergillus ter...
Q2U9V3       208 LEFKPHKTKRYRGMKKK----NPt--------------LGIPEVRS---EPCLLLCPQSFLLSLLIRKSAFSH-----LR 261 Aspergillus oryzae
EDN08847     241 MEVTLMFMKGKRNKSQPyipsPYcrrhawlgrmavltsPLRTTYIFherDDNPALCPISHFLSLALADRAFEA-----QG 315 Histoplasma cap...
XP_001544467 242 MEVSLMFMKGKRNKSQP------------------------TTYIFherDDNLALCPVSHFLALALADDAFDA-----RG 292 Histoplasma cap...
EBA27228     119 MRVRHRLNKGKRNKGVA------------------------PVFTYterNDNLGLCVIQDILEYAILDDAFAS-----QR 169 Aspergillus fum...
Q5B7D4       336 LDCPENLYK-LGVLDGLGQQELKLKDEILDQFVFCQAVREPDGIRIL-LGEQLTEGALRYRMKRGGEITGFEQVTKPYGL 413 Aspergillus nid...
XP_001542227 336 LTSARQLVD-LKIPKDTYQLELHLDPALNDVPVFRKSERTLEAIEIS-AIDALTYGTIKPWIRRIGEISAFRDIVRPYSL 413 Histoplasma cap...
XP_001536444 319 IRRPEDLYS-LGVLNGLNQQQLPLRDDLADLFVFCSAVREGGGVRIA-HEIRLTTASVRTRMKKGGEITGFQQVTKPYVL 396 Histoplasma cap...
EDN02495     327 LDCAEKLYS-AKVLDGKGQQPLLLKDELLDKFVFCQTEPTSTGFKIC-LDQRMTPSMVSSRMRRAGEITGFEEVAHPYNL 404 Histoplasma cap...
CAK45787     332 ISSARQLYA-LQVSKSAG--SLTLHPADPDAHLF-----------------DISARTLNSWLKRLGEITGFDLPITPYWL 391 Aspergillus niger
Q0C8S6       328 IVSAEKLYA-LQVPPDAGSLSL------------CPGEPEALLFDIS-------ARTLNAWLKRLGELAGFDLPITSYWL 387 Aspergillus ter...
Q2U9V3       262 ITSAAQLYA-LQVPPEAG--SLELRPANPECFLF-----------------DITPRTLNTWLKRLGELTGFNLSITSYCL 321 Aspergillus oryzae
EDN08847     316 INTPEDIFR-IEVPPYRNSLQLRWRPEMLDIPIFRRTYHTAHGVRIS-PDRALPYDAFNQYLQRLGRNSGLEEPLTPYCI 393 Histoplasma cap...
XP_001544467 293 INSVEDVLR-IRVMAPRNSLHLKWKPHMLNIPVFRRAVHTAEGIRIS-PDKALPYDTFNQYLQRLGRNAGFEHKLTPYCI 370 Histoplasma cap...
EBA27228     170 IKRPRDIWLyTHVPDHRLSTPIHFKESVKEIPIFRRAVKDSEGHWIThPTLALQYDRAQEYEIATSRSAGFKNPGSLYKY 249 Aspergillus fum...
Q5B7D4       414 RYGAAKAFNDSPEVTNELQNVMLQH-ASINTFVKHY-SVGIHVDAQAIVRGLPSQKQLMRFAASMSRSIDPRRPYRL--E 489 Aspergillus nid...
XP_001542227 414 RYGAGKALDNSGHVSEAVRSLIFQH-SDPRTFLKYYlHRKVDKDVRAIVQGLDPQEHIMRAACRMLRSVNPRRPQELttA 492 Histoplasma cap...
XP_001536444 397 RDAAAKGFNESSDVSDSLQNLMLQH-ASIDTFLKHYlDRNITADVLSIYRGLEPQKALMRMVCSMSRSIDPRRPWKLtpE 475 Histoplasma cap...
EDN02495     405 RYAGAKAFNNSEEVTEALQNVMLQH-ADIRTFVKHY-QVDVDVDAQGIVRKTGSQTALVQFACSMSASIDPNRPYKLspE 482 Histoplasma cap...
CAK45787     392 RRGAGEAANSSCEISEAQQNLLLQH-ASGSVYQKNYrPDYLPVDFNAAWRQLKPQVMIIRMASGQSRSIDRRRPIDLsgA 470 Aspergillus niger
Q0C8S6       388 RRGAGEALNSSCEISEAQQNLLLQH-ASGSVYQDRYaPDYFPKDFSAVWRGRQQQSDIIRIASGQGRSINLRRPIDLneA 466 Aspergillus ter...
Q2U9V3       322 RRGAGEAVNSSCEISEAQQNLLLQHaANSSVYQERYaPDYFPKDFSAVWRGSQPQNKVIRMASGQSRSIDLRRPVDLneA 401 Aspergillus oryzae
EDN08847     394 RRATANAVDD--VATAAERNQVLGH-SRADIFERYYlSQKVKRDVQSAYLGCPARESVIRAVGMMSLTRDPRVPKELtdE 470 Histoplasma cap...
XP_001544467 371 RRGTANAVDT--IATTSERNQVMGH-SRADIFERYYiSVKVKRDVQSAYLGCPARESIIQAVGRFSLTRDPRAPKELsnE 447 Histoplasma cap...
EBA27228     250 RKGAARHLDE------HSRNVIMGH-KRSGTF-AYY--VQVQDDTQSAFMETPARDALIKLATHSSLTRDASAPQDLsdQ 319 Aspergillus fum...
Q5B7D4       490 DTRCVNEIPCVRALQNRVSERKQyrdkmkrafekaeqdfqqNFGDYAHHKEVKelppptrqalysltkckkeytrASQRY 569 Aspergillus nid...
XP_001542227 493 QSRSVNQQPHIQELIRKRDLLSR------------------RLGRPFKKHKGTv---------------------KYELH 533 Histoplasma cap...
XP_001536444 476 QSRSVNDQPPILKIARRVAHLKKrrds----------taswLRGRVGQRYRRKaekdrrweak--yrrrvekherRDERY 543 Histoplasma cap...
EDN02495     483 ESRSLNYLPVVRGRQDTVQKRKRewedreaeleranrvcktSLGHLDDRVLAEsnpevlerl----evfrdrtaeAKSEH 558 Histoplasma cap...
CAK45787     471 EEIEARANLLVRRRLKCWLKYKQki--------------qrKHGTLASAAGTP----------------------LYAEA 514 Aspergillus niger
Q0C8S6       467 QEAEADSRPDVQRCKAQWQHAKQkv--------------qmMYGTVSKGKGTP----------------------LFEDA 510 Aspergillus ter...
Q2U9V3       402 QAAEADAQPKVQRCKARWEQSRLkv--------------qmAYGAMYKGKGKP----------------------LYQKA 445 Aspergillus oryzae
EDN08847     471 QKAAIEHDPHLAELNRQKQDLVSdi--------------ryQYGSVPKAQGTE----------------------LHAQH 514 Histoplasma cap...
XP_001544467 448 QKEAIERDPQLVKLCDRQRSLRKli--------------erKHGSVPKSKGTA----------------------LHREY 491 Histoplasma cap...
EBA27228     320 RKQELEKDPALISLKGKRDMLRAel--------------iaLHHQLRNGRGTD----------------------LYREF 363 Aspergillus fum...
Q5B7D4       570 CRAQRVFRNEWQRQRNRLVRENLERYKNEQPVIDSERQLSGKLLDSE-VKGALERTGYMTPQHMILIDTILTAP-GSTVE 647 Aspergillus nid...
XP_001542227 534 RKISCELAGARQRARDKLLRDVQEKFDFEEPLREIKRQLSGIEISKT-FGESRSTNEKVPPPQQRLISALLSLP-CETLW 611 Histoplasma cap...
XP_001536444 544 HKAVRRLRNEKQRARIELKRKILERYRQEQPVIDSERQLSGKVVDED-VRSALERSGYMTPEQMIMIDAVLTLP-PKTPE 621 Histoplasma cap...
EDN02495     559 NKATRELRNEKQRQRNRQIRENLERYKNEQPVIDLERQLAGKLVDTK-VMDTFEHEAFMPPEHLMFVDCVLTMP-GANLE 636 Histoplasma cap...
CAK45787     515 MKQRTRYYTALQASRREMKEKKRSRFNEEQPVQDVIRQVHGLPLETYnVCDDVALSQ----ERRKAIVILFRFA-PTSEQ 589 Aspergillus niger
Q0C8S6       511 MKKRNTYHTARQAARRVMKEAIREKFNKEQPVADIIRQVHGLPLESG----DRRDAGPVPPEQYRAFSMLFRFA-PTTER 585 Aspergillus ter...
Q2U9V3       446 MKRRNAYHTARQAARREMKAVIRARFNEEQPTDDIIRQVHGLPMKSR----KAYKTELVPLEQQRAFSLLFRFA-PETER 520 Aspergillus oryzae
EDN08847     515 SKLEKTIQSERRFLRKLARDNIREDFFAKIDTIEIERQLLGLSLTDD-LKVEDSVAQFTCVERARLARSLFRSLgSSAAE 593 Histoplasma cap...
XP_001544467 492 TELGDTIRAEKQTLHREAFEDMRQEFFATIDTVEIERQLLGLSISEElKMDDEDKVQFVFEERARLARNLFRSSdCRTED 571 Histoplasma cap...
EBA27228     364 QRASNKVRSERKKLYRAAKNQEHTEFFENVGNHIIEQNYQGNPISFE------PDVSHVVPERKALADLEFKNRdVDKIN 437 Aspergillus fum...
Q5B7D4       648 KE--YQRRIAAINAVIAF 663 Aspergillus nidulans
XP_001542227 612 DE--MLRRTEGIDAVAAY 627 Histoplasma capsulatum NAm1
XP_001536444 622 AE--LQRRITAIHAVSAY 637 Histoplasma capsulatum NAm1
EDN02495     637 AE--YQRRINTINAGVAF 652 Histoplasma capsulatum NAm1
CAK45787     590 DE--TNCRIAAVDAVSQI 605 Aspergillus niger
Q0C8S6       586 EE--TECRAAAVDAVAKV 601 Aspergillus terreus NIH2624
Q2U9V3       521 DE--TEYRAAVIDAVSKV 536 Aspergillus oryzae
EDN08847     594 EDkpHRHRMQVIHDWTAL 611 Histoplasma capsulatum NAm1
XP_001544467 572 QHelYIRRVQTSQDWVSL 589 Histoplasma capsulatum NAm1
EBA27228     438 DAelVEDRIRSLELRLAL 455 Aspergillus fumigatus Af293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap