1LY8


Conserved Protein Domain Family
Peroxidase_ext

?
pfam11895: Peroxidase_ext 
Fungal peroxidase extension region
This region is found as an extension to a haem peroxidase domain in some fungi. This region is about 80 amino acids in length and forms an extended structure on the surface of the peroxidase domain pfam00141.
Statistics
?
PSSM-Id: 403189
View PSSM: pfam11895
Aligned: 26 rows
Threshold Bit Score: 98.9283
Threshold Setting Gi: 597974255
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LY8_A       268 MGQRFRAAMAKMSVLGFDRNALTDCSDVIPSAVS-NNAA--PVIPGGLTVDDIEVSCPSEPFPEIATASGPLPS 338
A8NK72       288 MGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSnNAA---PVIPGGLTVDDIEVSCPSEPFPEIATASGPLPS 358 Coprinopsis cinerea o...
EKM51406     289 LTSDFQFIFLALTQLGQNPDAMTDCSAVIPISKPiPGNGpfSFFPAGKTSADVEQACASTPFPSLTTLPGPTTS 362 Phanerochaete carnosa...
EMD37100     286 MQAQFKAAMAKLAVLGQDVSQMVDCSDVIPVPLPpATT---PHIPAGLSQNNIEQACATAAFPTLPIDVGPQTS 356 Gelatoporia subvermis...
EMD32647     287 qQTLFKAAMSTLATIGQDTSTLTDCSDVIPVPAApVGT---PHFPAGLTNADVDQACTTAAFPTLSTDPGPATS 357 Gelatoporia subvermis...
EMD32649     287 MQTLFSAAMSTLAVIGQDTSQMVDCSDVIPVPPPpQGT---AHIPAGLSNADIEQACATAAFPSLPVDPGPATS 357 Gelatoporia subvermis...
ESK91034     284 IQSTFKAAMKKLALLGQNQNELIDCSEVIPVPKPvTDS---PHLPAGLNQNDIEQACATSAFPALTADPGPATS 354 Moniliophthora roreri...
XP_007328142 279 MASAFSDAMVKLSLVGQDKSQLIDCSDVIPRTIPlTNE---PYFPADLTKDDLEKTCP-DEFPDYPSNP-SVTS 347 Agaricus bisporus var...
XP_007334143 280 MAREFSKAMVKISLLGQDKSKMIDCSDVIPQATPlRSK---SYFPADLTVQDLEKTCK-KPFPRLPSNP-SVSS 348 Agaricus bisporus var...
EMD37368      32 MTHNFKATMFKLAFPSHDRASLMDCSDGVPAPKHaVNKP--ATVRASTGPKGLELSCFAERLPALPVAPGATQI 103 Gelatoporia subvermis...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap