Conserved Protein Domain Family
TOC159_MAD

?
pfam11886: TOC159_MAD 
Translocase of chloroplast 159/132, membrane anchor domain
This is the membrane-anchor domain of translocase of chloroplast 159, TOC159/132. This domain is present in plants at the C-terminus of the GTPase, AIG1, pfam04548, and anchors the GTPas region to the outer membrane of the chloroplast. The domain may carry a very C-terminal sequence motif that resembles a transit peptide.
Statistics
?
PSSM-Id: 403181
View PSSM: pfam11886
Aligned: 27 rows
Threshold Bit Score: 324.602
Threshold Setting Gi: 552831201
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009144557  645 RAPVTLPDMVLPPSFDSDNSAYRYRSLESTSQFVTRSELDTQVWDHDCGYDCVIAEHSLAIAKRFPVAITVQMTQDKEEF 724  field mustard
XP_003063586  557 QVAVPAPDPALPPSFDGDNPSHRYRFLEPQSQWMVRPIVEAHGWDHESGIEGFSVDKGFVLRNSIPGQMSGQLTKDKKDS 636  Micromonas pu...
ERN13395      711 SVPVTIPDVTLPASFDSDNPTHRYNCLDLPNQWLVRPVLEVHGWDRDVGYEGLNVERLFVVKNKIPISVSGQITKDKKET 790  Amborella tri...
Q9SLF3        931 SVPVPMPDLSLPASFDSDNPTHRYRYLDSSNQWLVRPVLETHGWDHDIGYEGVNAERLFVVKEKIPISVSGQVTKDKKDA 1010 thale cress
XP_010647096 1001 SVPVPMPDWALPASFDSDNPTHRYRYLDSSNQWLVRPVLETHGWDHDVGYEGINVERVFAIKDKIPVSFSGQVTKDKKDA 1080 wine grape
XP_009383994  903 SVPVPMPDFVLPNSFDSDNPTHRYRFLDSSSQWLVRPVLDSQGWDHDIGYEGLNVERVFVIKDKMPLSVSGQLTKDKKEC 982  wild Malaysia...
Q94LU7        739 NVAVPMPDMVLPSSFDSDHPSHRYRFLDTPSEWLVRPVLETQGWDHDVGYEGLNVERLFAVKGKVPLSVSGQLSKDKKDC 818  Japanese rice
EFJ12178      581 PVPVPLPDMQLPPTFDSDNPVHRYRYLETASQWLVRPVMDLHGWDRDSGYDGFNMERMFTYG-KIPASLSGQVTKDKKEA 659  Selaginella m...
EDQ63890      866 TVAVPMPDMALPPSFDSDNPTHRYRYLETANQWLVRPVLETHGWDHDAGYDGFNVEKMFVVKEKIPASVSGQVTKDKKEA 945  Physcomitrell...
NP_001031912  378 QAAVPLPDMAGPDSFDSDFPAHRYRCVSAGDQWLVRPVYDPQGWDRDVGFDGINIETAAKINRNLFASATGQVSRDKQRF 457  thale cress
XP_009144557  725 DIHLDSSVCAKHG-DNGSTMAGLTVRSVSNQLMYVVVGETKFNNFRKNKTTLGGSVTFFGEDVAIGLKLEDHITLGKRIV 803  field mustard
XP_003063586  637 NVGFEGQISIPHT-KKLVTTTGVDIQTVGKQLAYTARGETRWKFCAVNKIAAGLSASIVGGALALGTKLENRWKVTPGAK 715  Micromonas pu...
ERN13395      791 NLQMECTGSLKHG-EGKSTSLGFDAQTVGKEVAYTLRSDTRFANFRYNKTAAGLSVALFGDAITAGVKLEDKLLVKKWFT 869  Amborella tri...
Q9SLF3       1011 NVQLEMASSVKHG-EGKSTSLGFDMQTVGKELAYTLRSETRFNNFRRNKAAAGLSVTHLGDSVSAGLKVEDKFIASKWFR 1089 thale cress
XP_010647096 1081 NLQMEIASSVKHG-EGKATSVGFDMQTVGKDMAYTLRSETRFCNFRKNKATAGLSITALGDAITAGLKLEDKLIVNKRIR 1159 wine grape
XP_009383994  983 SLQMEVASSIKHS-ESKSTSLCLDMQTVGKDVAYTLRGDTRFKNFRRNNTAAGVSVTVLGDSLSAGLKFEDKLMISQRLR 1061 wild Malaysia...
Q94LU7        819 SLQMEVASSLKHG-EGKTTSLGLDLQSVGKDMAYTLRGESRFKNFRRNNTAAGISATLLGDSVSAGVKVEDKLVVNKQLR 897  Japanese rice
EFJ12178      660 NVTLECAASMKHG-EGKVSQAGFDVQTVGKDFSYTLRSETRFSNFKKNKTIAGLAMTMIGDTLAYGMKIEDRLMIGRRVK 738  Selaginella m...
EDQ63890      946 QVNFEAAASLRHG-EGKVTLTGFDVQTIGKDLAYTVRAETRFNNFKRNKTTAGVTATYLNDTIAAGVKLEDRVLIGKRVK 1024 Physcomitrell...
NP_001031912  458 TIQSETNAAYTRNfREQTFSVAVDLQSSGEDLVYSFQGGTKLQTFKHNTTDVGVGLTSFGGKYYVGGKLEDTLLVGKRVK 537  thale cress
XP_009144557  804 LAGNAGTVQSREESAYEANLEVRLREDDFPIGQNQSALGLSLTKSKeEDLTLSANLRSQVSIGRQTKVAAFASLDTKRTG 883  field mustard
XP_003063586  716 LIVSAGAVSANKDVAYGGNCEAQIKHSDDPSNPNSSTVGMSFMNWR-GDVALGGNAMSSVTLGKDTQLTARANLNSRGAG 794  Micromonas pu...
ERN13395      870 VVMTGGAMVGRGDVAYGGSLEATLRDKDYPLGRFLSTLGLSVMDWH-GDLAIGCNLQTQFPVGRWFNMIARGNLNNRGAG 948  Amborella tri...
Q9SLF3       1090 IVMSGGAMTSRGDFAYGGTLEAQLRDKDYPLGRFLTTLGLSVMDWH-GDLAIGGNIQSQVPIGRSSNLIARANLNNRGAG 1168 thale cress
XP_010647096 1160 LVMTGGAMTGRGDVAYGGSLEATLRDKDHPLGRSLSTLGLSIMDWH-GDLAIGCNIQSQIPIGRFTNMIGRVNLNNRGAG 1238 wine grape
XP_009383994 1062 VLMSGGAMTGRGDVAYGGRLEATLRDKDYPIRQALSTLQLSIMDWH-GDLTLGCNVQSQLPLDRGTNLIGHANLSNKGTG 1140 wild Malaysia...
Q94LU7        898 VLVSGGAMSGRGDVAYGGRLEATLKDKDYPIGRMLSTIALSVVDWH-GDLAVGCNIQSQIPAGRASNLIGHANLSNKGTG 976  Japanese rice
EFJ12178      739 VVMNGGALTGKGDTAYGGTVEISLRDKDFPLGRSLSTCGLSVMNWH-GDMALGGNLQSQFMVGK-TMVVARGNLNNRGAG 816  Selaginella m...
EDQ63890     1025 LVVNGGVLTGKGDKAYGGSLEATLRGKEYPLSRTLSTLGLSVMDWH-GDLAIGGNLQSQFMVGK-TMMVGRANLNNRGSG 1102 Physcomitrell...
NP_001031912  538 LTANAGQMRGSGQTANGGSFEACIRGRDYPVRNEQIGLTMTALSFK-RELVLNYGLQTQFRPARGTNIDVNINMNNRKMG 616  thale cress
XP_009144557  884 RFTVRTSSSDQLQIAVMAILPLAMSIYKR 912  field mustard
XP_003063586  795 QLTLRATTNERLQLAGLGLVPLLCALIGR 823  Micromonas pusilla CCMP1545
ERN13395      949 QVSIRLNSSEQLQIALLGLIPILRNLMKn 977  Amborella trichopoda
Q9SLF3       1169 QVSVRVNSSEQLQLAMVAIVPLFKKLLSY 1197 thale cress
XP_010647096 1239 QVSIRLNSSEQLQIALIGLVPLLRKLLGY 1267 wine grape
XP_009383994 1141 QIGIRLNSSEHFQIVLLALFPIIRNVQKI 1169 wild Malaysian banana
Q94LU7        977 QVGIRLNSSEHLEIALIALVPIYQNIKKL 1005 Japanese rice
EFJ12178      817 QITIRLSSSEQLQIALIGVIPLIKALFNS 845  Selaginella moellendorffii
EDQ63890     1103 QVSIRASSSEQLQMVLIGIVPILRSLINC 1131 Physcomitrella patens
NP_001031912  617 KINVKLNSSEHWEIALISALTMFKALVRR 645  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap