Conserved Protein Domain Family
DUF3405

?
pfam11885: DUF3405 
Protein of unknown function (DUF3405)
This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 636 to 810 amino acids in length.
Statistics
?
PSSM-Id: 403180
View PSSM: pfam11885
Aligned: 115 rows
Threshold Bit Score: 475.521
Threshold Setting Gi: 1030144333
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEU48519          293 CFDRYGRYGPYGFGYssrngglsvgehgqkEGSDAVW-D--------KTPKVDYRQVDWAEVQRRCFKANQARFKAlppk 363  [Nectria]...
Q2GPK2            118 SVR--QRYGPYGFGDnrs---------------------------dyKRQKVDWDQVDWGQLQNDCFQRNRDRFPMaatr 168  Chaetomiu...
jgi:MYCTH_2308049 120 NVD--RRYGPYGYGEere---------------------------dyNRSRVDWNQVDWGQLQNDCFERNRHRFPAsatr 170  Thermothe...
Q2H7Y0            120 TAA--ERYGPYGWGDdkp---------------------------tyGKTKVAWDSADWAALQNQCLARNSQRFKDptpl 170  Chaetomiu...
XP_016756720       86 TFE--QRYGPYGYEKnsss------------------------earhTSPSVDWNSVDWGALVDECAKANDARFRLpkvm 139  Sphaeruli...
XP_002565973      150 CADRYSRYAAYGYAD---------------E-----------------GEKVQWQDVDWATLQQDCLQRNADRYQPsk-- 195  Penicilli...
CAP97356          173 CADRYSRYGAYGYLG---------------GNETTLH-NwdgtfgsnEASEIDWEQVDWAHLQYECLQRNSVRYRTqpse 236  Penicilli...
Q5ATC5            144 CTTRASRLAAYGYSE---------------SGLNST------------ADPIVWDNVNWGTLQSECLQRNINRYHEpkrt 196  Aspergill...
Q0CS19            196 CFDRYSRYKPYGYGL---------------DTGVDVPaAh-------PSVNVTWDEVDWADLQAQCLHRNARRYKG---- 249  Aspergill...
EPS33487          198 CTDRFSRFGAYGYGA---------------DNDDEIP-Gf------qRPEPVQWDNVDWNALQNQCFERNADRYKP---- 251  Penicilli...
EEU48519          364 tltphgffihepkapapsaslerrgvevektnpgkeaatpeptvsksekpkteeaksqdskstqsapaeskateskaaes 443  [Nectria]...
Q2GPK2            169 fedtr--------------------------------------------------------------------------- 173  Chaetomiu...
jgi:MYCTH_2308049 171 fddtr--------------------------------------------------------------------------- 175  Thermothe...
Q2H7Y0            171 rag----------------------------------------------------------------------------- 173  Chaetomiu...
XP_016756720      140 sqrr---------------------------------------------------------------------------- 143  Sphaeruli...
XP_002565973          --------------------------------------------------------------------------------      Penicilli...
CAP97356          237 gk------------------------------------------------------------------------------ 238  Penicilli...
Q5ATC5            197 prl----------------------------------------------------------------------------- 199  Aspergill...
Q0CS19                --------------------------------------------------------------------------------      Aspergill...
EPS33487              --------------------------------------------------------------------------------      Penicilli...
EEU48519          444 kvaeskaaepvpvvskaAepkaqesk-teethetkTEKSNSASTE-QPKAPQVKKARTAVVVRCWDEYHWREDDIANIRS 521  [Nectria]...
Q2GPK2            174 ---------------------------itkprfsfRESTKIPPVR--HWHEFEASRRTAIVVRAWRGYEYLPEDMYYLRS 224  Chaetomiu...
jgi:MYCTH_2308049 176 ---------------------------vtpprfalRHVAKVPEVR--HWHEFQPTRRTAVVVRAWRGFEYLPEDMYYLRS 226  Thermothe...
Q2H7Y0            174 -----------------------------errfrmREASEEVRLPvVEPQAAEHVPRTAIVFRVFEGYNYTAEDLVNLRA 224  Chaetomiu...
XP_016756720      144 ---------------------------prfrlfddNDAKQHQEEE-ETEVPQHETGRQAIILRTWSTYEYYPEDLWNLRS 195  Sphaeruli...
XP_002565973      196 ----------------iGqktqtlhrehdketdehRWAGGRTETD-RNKTSAVFKPRTAVVLRTWLGMEYTEDDLYYIRS 258  Penicilli...
CAP97356          239 -----------------------------ifalykSLDSDVQPRE-PLNGTDKMQPRTAVILRSWIGMKYTENDLYHIRS 288  Penicilli...
Q5ATC5            200 ----------------------------silplnpIRTEAPANDD-EGISSPATKKRTAVVLRAWHDIVWTENLKEHVRS 250  Aspergill...
Q0CS19            250 -----------------HptkrppvshpltqsfskSEAPLLMQEPsAPVSGPQYQPRSAVLIRAWHTIKWTPNHLQYLRS 312  Aspergill...
EPS33487          252 -----------------HgtaspaargplafestpSSHPADNAES-ADTGMKQYHARSAVLIRSWHSMLWTPNHREYLRA 313  Penicilli...
EEU48519          522 LITELAVTSGGRYDIHLLVQIKNEAAh--PVWA-DQDTYRERIEET-IPEEFRGLVTLWSETQMLALYQGIY---DHfsr 594  [Nectria]...
Q2GPK2            225 LVAETALKTGGEYQVILLVDMKDYEGyenDIFS-SDDAYARGLEDAgVPPEFQSITLLWSVRLLEDWYPMIEeh------ 297  Chaetomiu...
jgi:MYCTH_2308049 227 LVAETALKTGGEYQVILLVDMKDYEGyenDIFA-SEEAYKKGMEDAgVPPEFQSITLLWTNRLLDSWYPRVEeh------ 299  Thermothe...
Q2H7Y0            225 TTAETALRYGGEYTVFILVDVKDKGR---DIFA-SEDNYQRAVREL-VPAEFRNIAVLFDETLLQSWYPSIKth------ 293  Chaetomiu...
XP_016756720      196 IITEASLATHGDYQVFLLVDLKCGEAc-qDVFT-NATLHQEILEKS-VPKEFWNVAVLVHENLQRSWYPKVEet------ 266  Sphaeruli...
XP_002565973      259 IIMELSLLSGAEYEVIILVDTKDVEV---PHPA-DKAGLDSLKIS--LPRELQDLAVFFNAEILEDWYPKIDih------ 326  Penicilli...
CAP97356          289 MLMELSLYSGAEYELILLIDSQGKKL---PKKD-DHAAWKAFNAKH-LPQELRSLAVWFNAEILKDWYPGIEvh------ 357  Penicilli...
Q5ATC5            251 LIMELSLHSGAEYEVFLLTHVKDNDL---LLCGvDEAKIRALKKKF-IPREFWDITVLFDERTLQSWYPKVDeh------ 320  Aspergill...
Q0CS19            313 LIMELSLHSGAEYEVFLLIDVKDDFL---PIFS-DASTVRYLKDLF-IPAEFRNMTIFFNNKLLEGWYPLLEehrYCpfh 387  Aspergill...
EPS33487          314 MIMELSLHSGGEYEVFLLVHVKDDAL---PLFS-DPQTVHDLRET--IPPEFRNMALFFNTKLLEAWYPKIEeh------ 381  Penicilli...
EEU48519          595 -----------gpdLpvhgVYRGLSMAMQYFAYMHPEYDYFWQWEMDVRYTGHYYDLFSKLENWARDQPRKGLWERNSRF 663  [Nectria]...
Q2GPK2            298 ------------------rTMWQVFQPMQLLALHYPEFDHFWQLELDMRFLGDAGKFLDRLAATARNEPRKQALERSTFW 359  Chaetomiu...
jgi:MYCTH_2308049 300 ------------------lTIWQVFQPMQLLALHYPEFDHFWQVELDMRFMGDAGKFLDSLSAAARREPRKQSLERSSFL 361  Thermothe...
Q2H7Y0            294 ------------------iTTYQVMQPLQLFGYFYPEFDHYWQLELDLRFTGHAGRYLAGMSDFAREQPRKQAMERSTWF 355  Chaetomiu...
XP_016756720      267 ------------------rSMWQIMQPLQLFAHFYPEFDHYWQLEMDARFTGNVGNMLQAFDLFGREQPYKQARERASWA 328  Sphaeruli...
XP_002565973      327 ------------------eAILQYFQPMQIFSRVNPQYDFFWQFEMDSRYTGHFYNFLQQAAEFAKQQPRKNLWERNSYF 388  Penicilli...
CAP97356          358 ------------------vAILQYFQPTQIFSRLHPQYDYVWQFEMDSRYTGHMYDLLHKAAEFAKQQPRKYLWERNSHF 419  Penicilli...
Q5ATC5            321 ------------------rPVYQYAQPLQIFSTVFPDFHYYWQLEMDARFTGHTYHFLERASEFAKQQSRKYLWERNAYF 382  Aspergill...
Q0CS19            388 yptaspsctesnpsR----PMYQHLQPVQIFSQLYPDFDYYWQFEMDSRNTGHMYHFLDRAVEFAKQQPRKYLWERNAYF 463  Aspergill...
EPS33487          382 ------------------tPVLQHHQPIQIFAQLYPQFDYYWQFEMDGRHTGNVYQFLDKAISFAREQPRKYLWERNAYF 443  Penicilli...
EEU48519          664 YFPSVHGSWEDFSQMARVQSQMgvvgadnvwkkvpgldldgkspdadtkGDRTVWGPLRsnddndwfepgN-------D- 735  [Nectria]...
Q2GPK2            360 HMIAEIGDYGEFFAAVNEANRG----------------------------GSHAWGPLKvnei------------lpiG- 398  Chaetomiu...
jgi:MYCTH_2308049 362 HMIAETGDYGEFFRVVNESNKG----------------------------GSHAWGPMRvrei------------lpiG- 400  Thermothe...
Q2H7Y0            356 YMPEFHGGYSDLLAAVNASLEG---------------------------KGGLGWG-MKiqdf------------eplG- 394  Chaetomiu...
XP_016756720      329 YMSSQHGTYAEFSSAINSSLNG----------------------------NATIWGPDRiknveplll--pnnndnknD- 377  Sphaeruli...
XP_002565973      389 YTPAVHGSWDNFIDQVDQSMTN----------------------------LDSIWGPQPakgi------------evgNe 428  Penicilli...
CAP97356          420 YIPAVHGTWEEFMEKVDQEMPGh--------------------------DNSSVWGPRPaegi------------dieGq 461  Penicilli...
Q5ATC5            383 YIPGAHGTWEEFMHTVDKSLLKr--------------------------ESNTVWGPAP-----------PhswiqpvG- 424  Aspergill...
Q0CS19            464 YTPGAHGPWEQFMGMVNESMVG----------------------------RRSVWGPVPakgi------------mptG- 502  Aspergill...
EPS33487          444 YTPGAHGPWQEFMDMTNHSLEGl--------------------------SKNTVWGPVLgtgi------------rplG- 484  Penicilli...
EEU48519          736 -PVAPTSYEKD-HYQWGVGEEADYIALNPIFNPE----GTSWGLREDITGF-N-RTegLPPRRANIITTSRMSRRLLTTM 807  [Nectria]...
Q2GPK2            399 -PEPPVADPRDeNFEWGVGEEADVITTSYCMDALi---pNEWVFKNWIHGFrT-GP--RTPRFYCPPAIQRGSRSLYLAI 471  Chaetomiu...
jgi:MYCTH_2308049 401 -PEPPVADPRDdNFEWGVGEDADALLTAFCQNANt---pNTWIFRDWIYGLrT-GV--RTPRFYCPPAIQRGSRALLLAI 473  Thermothe...
Q2H7Y0            395 -PQPPVDDPLEdNFEWGVGEEADFIAVGPCAHVQy---mVDWAWRNWYQGLkA-GT--KTPRWMCQPAMGRASRTLLQAA 467  Chaetomiu...
XP_016756720      378 -PLPP--SPLQdNFTHALHRPADLLLLTQLNDVRlferHSDWVFAEWYLGGfT-PH---IPRYMSVPAQARASYSLLEAI 450  Sphaeruli...
XP_002565973      429 aPEALRSDLDDdSWTWGVGEEADVITWLPQFNPR----HTDWPFRTRVYNFrQkQR---TPRRASVVAMSRVSARLLRLM 501  Penicilli...
CAP97356          462 aIIPPVPRLADePGSWGVGEEADLITWLPHFNPV----GTDWPFRDRVFNFpQdQE---TPRWAAVVAMSRISARLLGLL 534  Penicilli...
Q5ATC5            425 -PEPPISSPQDdDYEWGVGEEADLITFLPIFDPS----DTTWVFWNLLWNLpI-ET---TTRRTSPVMIGRFSHRLLQVM 495  Aspergill...
Q0CS19            503 -PMPPVSTPEEdDYEWGVGEEADLITFLPIFDPS----ETTWTFPDTLYNLp--LE---TPRRASPVTMWRLSKRLLDLM 572  Aspergill...
EPS33487          485 -PEPPTQSPDEdNFSWGVGEEADMITFLPVFNPK----ETTWTFPDKIWNFkNgLE---TPRRAAVITMGRYSKRLLGLM 556  Penicilli...
EEU48519          808 HKMTAFKKQFAFPEMWPATVALHHGYKAVSAPHPVFV-------D----RSW-PTAYMAQVYNN--GRDG-----SSGGS 868  [Nectria]...
Q2GPK2            472 HQAQMEQGVRIPSEATLPSFALWHGLKLAFPQHPVFHrd---kdNhqdrRGW-WRG----------GPR----------A 527  Chaetomiu...
jgi:MYCTH_2308049 474 HQAQLDLGIRIPSEATLPSFALWHGLKLSFPQHPVFHrd---ndDvenrRGW-WRG----------GPL----------A 529  Thermothe...
Q2H7Y0            468 HHAQAAQGLAVHSEATLSSFALWHGFKLVAPPHPVYQ-------N----PQW-PLDKMYKLYNGpgDVEShqksgMVGMA 535  Chaetomiu...
XP_016756720      451 HRSQHEQGLRVASEATLPSWALWLGLKIVGLPIPRFQfpereahE----LGW--------VLNG--GLPGekgrfEDGIA 516  Sphaeruli...
XP_002565973      502 HADKTEKGLGLASEMSPTSWALYYGLKAVQVPQPIYH-------A----HDTnP-VELNLRANS--GKPG-----KISAG 562  Penicilli...
CAP97356          535 HKDKVKSGVGLASEMSPISWALYYGLKAVQIPQPVYH-------D----AKWdP-EELNRRANP--GEPG-----QVNAG 595  Penicilli...
Q5ATC5            496 HNAQIEQGVALVSEMMPSSFALWHGLKAVHAPHPIYA-------D----GKWmP-KELNNIVNKvaGGPE-----KINGG 558  Aspergill...
Q0CS19            573 HHDQATTGIGLGSEMSGPTWALWHGFKAVHVPHPLYL-------D----GHWtA-KELSRVYNP--GEPD-----KINGG 633  Aspergill...
EPS33487          557 HQAQATRGLGLASEMSGVSWCLFHGLKAVHVPHPIYA-------D----GQWtP-QELARIYNR--GSPD-----NINGG 617  Penicilli...
EEU48519          869 RTSIFGD-R--EHNMHGLSWFYNSGFAPNLYRRWLGLRVN------------------NDGGEEF---EAtedkskkg-- 922  [Nectria]...
Q2GPK2            528 SSTGLGPdDsaHPNGRGLTFWWESTWAKNVFNEWYGRKLDgnkpr----------------------------------- 572  Chaetomiu...
jgi:MYCTH_2308049 530 SSTGLGPdNndHPRGFGLSFWWESNWAKHVFNEWYGRKLSdkepr----------------------------------- 574  Thermothe...
Q2H7Y0            536 HGKAIYRiTpyAYITTSSSFWYSSPFPDEIYDAWLSRGPQ--------------------GGNASaevpy---------- 585  Chaetomiu...
XP_016756720      517 RGDGVYRgSslGFFLRPLTFDWWSSLCDPMWEWWMMEGEE--------------------GEDGErerEEeerkkkdgnh 576  Sphaeruli...
XP_002565973      563 WNSIWSWnQh-NDILMKMSYMFGSEFPEKIYRAWLGYDDS----------------------------EK---------- 603  Penicilli...
CAP97356          596 FNSIWSWgQh-DDIMYNTTFMFNSEFAEKLYRAWLGYD----------------------GAKEW---EK---------- 639  Penicilli...
Q5ATC5            559 KDSFWNWdHklDHIVYRMSYMFTGQPAEDFYRRWLGYKPNpaq---------------ytDGSRH---QD---------- 610  Aspergill...
Q0CS19            634 PHSVWNWnHmvDRIMYRFSYMFTTQTAEDLYRRWLGYPPDpseredgrlpkdtwglmwYEGGQLN---EE---------- 700  Aspergill...
EPS33487          618 HDSIWNWdHlyDHIMYRLSYMFTTFTAEDLYRRWLGYKTTdn-----------------kGSTKAs--EA---------- 668  Penicilli...
EEU48519          923 ---------kgvgnmrGGEGRMCLPPMLLHPVKE 947  [Nectria] haematococca mpVI 77-13-4
Q2GPK2            573 -----------pwiikEWDNELWLPNMMLHPVKH 595  Chaetomium globosum CBS 148.51
jgi:MYCTH_2308049 575 -----------pwiikEWDGKLWLPNMILHPVKH 597  Thermothelomyces thermophilus ATCC 42464
Q2H7Y0            586 ------------vlwrSENGTVYAPNMMLHPVKt 607  Chaetomium globosum CBS 148.51
XP_016756720      577 peyvvvpkkelpgfmhMVDGEVYMPEMLLHPRKs 610  Sphaerulina musiva SO2202
XP_002565973      604 -----------------DGHRLCLPPMFLHPVKN 620  Penicillium rubens Wisconsin 54-1255
CAP97356          640 -----------------ENPRLCLPPIFLHPVKN 656  Penicillium rubens Wisconsin 54-1255
Q5ATC5            611 -----------------PQGRNWFDGGHLnteld 627  Aspergillus nidulans
Q0CS19            701 -----------------TYGRLCFPPMFLHTIKN 717  Aspergillus terreus NIH2624
EPS33487          669 -----------------QYGRHCFPSMFLHTIKN 685  Penicillium oxalicum 114-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap