Conserved Protein Domain Family
DUF3404

?
pfam11884: DUF3404 
Domain of unknown function (DUF3404)
This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is about 260 amino acids in length. This domain is found associated with pfam02518, pfam00512.
Statistics
?
PSSM-Id: 403179
View PSSM: pfam11884
Aligned: 11 rows
Threshold Bit Score: 325.107
Threshold Setting Gi: 501607742
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MCR6        19 AVPTLASIDLPETQRWSIFYRAALEQQSTPLVASQt-lNQYPFALLSSHSQYPDFTQYTWQDIADLAATAKQCQPRNSSS 97  Vibrio vulnific...
WP_009845362  23 SVNAFADSLPERIDNFTKLFDHEMAIESYDIRLLQ---ADYPTRLIMPSSMLPQTAEYPLKDIQRLYRLSKTCSGKLPLS 99  Vibrio
Q7ME74         8 VPSALADSLPERIDFFTELFNYDSASKTYDIRDLQ---SSFPTKLLSPDSMLPQTANYPLKDIQQLYQLSKTCNGKLPLS 84  Vibrio vulnific...
Q87HP3        17 SAPALSDSLPERIDTFTELFNYEVALKSYDIRILQ---SNYPTKLLSPDSLLPQTSDYPLKDIQQLYSLANTCRGKLPLS 93  Vibrio parahaem...
Q6LJF1        29 SAVAQDNTTNLQ-TLWQQFYQQAG-LLSPQKNISQadiNHYPKSLLLSSSQYPIFSQFHWQEIQQLWQTGEQCQ---QNQ 103 Photobacterium ...
WP_022560646  13 cLSASSWAEVIQ-DKWQNFYQQA--WQNASLVVSQqslNHYPNELLLEAAQYPDFDAFSWQELALVSSVRKHCQPAESDN 89  Vibrio nigripul...
WP_012600721  13 wLPTLANAQSLQ-DKWQTLYQLS--WQSSPISVSQkelTQYPKALLQESSRYPDFNKFSWEDIAALASIQDHCQAIERSN 89  Vibrio tasmanie...
Q5E016        15 SFSSHADSLATKIDNFKKAFKKQQAVEIYDIRLIQ---KEYPTVLLSPDTLLPQTASYPFKQLQRLYRSAQTCTGPWPVS 91  Aliivibrio fisc...
CCO60911      15 SSGAYAQSLPERIEEFKSQFDTSKAIDSYDMRVIQ---SDFPNKLLTPESMLPQTASYPLRDIQRLYKLSESCKGKLPLS 91  Vibrio nigripul...
WP_014257313  24 STSSYADSLPERIDLFVSLFDYQSAVVSYDIREIQ---NDYPTRLLTPDTMLPQTSAYPLKDIQQLYSLAQTCTGKLPLN 100 Vibrio furnissii
Q9KM24        32 PNPVHADSLPERIDLFVSLFDYNSATTSYDIRSIQ---TDFPTRLLTPDSMLPQTSEYPLKDIQLLYKLAQSCTGKLPLS 108 Vibrio cholerae
Q7MCR6        98 PHLAK-----AVEFELALCRQTPLGAEWFQRVAWQHPAGGSYADRYIEHLPDS--EQASFASTHSTRFTLASRyhpLHAL 170 Vibrio vulnific...
WP_009845362 100 PLITE-----PLVFTRAMCKGTKLSDRWFTRSGLIHPGGGSYAARYVELYPEKfdSLKRYMHIQERPNTEHDE---LLSR 171 Vibrio
Q7ME74        85 PLITE-----PLVFTRSVCKGVKLNTRWFSRSALIHPGGGTYAARYIQKFPEEheNLKKFMHIKERMDEEGNE---LLSS 156 Vibrio vulnific...
Q87HP3        94 PLITE-----PLVFTRAICKGTQLTPRWFSRSGLIHPGGGTYAARYVEKYPELrpKLAQYMHIKERDNEEGDE---LLES 165 Vibrio parahaem...
Q6LJF1       104 PLVTKaalhvAIEFELALCQKKPLANSWFDEVPLLHPAGGSYADRYLASLDKPhrEL--FLAQHRRQLTLANQehpLHAL 181 Photobacterium ...
WP_022560646  90 PVIAD-----AIEFELVLCHGTTLDVEWFQSHTLLHPAGDSFADRYAELYPQSktELTPF-------FTLANPdhpLFDI 157 Vibrio nigripul...
WP_012600721  90 PSLND-----AIEFELAVCQQQPLDSIWFAAHSKRHPAGGSFADRYVARYPENseQIHPF-------LSISNPlhpLFSK 157 Vibrio tasmanie...
Q5E016        92 PLVGE-----PLVLIRAMCRGIKLPTSWFARSGMIHPGGGSYAYRYVQLHPDAkeHLSPYMHIKERAVASEGT---LLHH 163 Aliivibrio fisc...
CCO60911      92 PLITE-----PLVFTRAICKGTRLPIKWFARSGVIHPGGGTYAARYAVTYPAMydELEDYMHIEERPEAGPNS---LLGR 163 Vibrio nigripul...
WP_014257313 101 PLVTE-----PLVFTRAICKGTQLPMRWFARSALIHPGGGTYASRYAEVHTDKtsDLQQYMHIQERPQAETNT---LLGR 172 Vibrio furnissii
Q9KM24       109 PLITE-----PLVFTRSLCKGSSLSPRWFARSGLIHPGGGTYAFRYAEKYPAQfaNLLPYMHIQERPNAAEGT---LLYH 180 Vibrio cholerae
Q7MCR6       171 WQRPGGAGVDALLNGFRLYlAPNDELWLSSEAGWHVLSSVQWHALTAPLPFTLEPYQAQKPCDERYSNLCFNQRVSnHAL 250 Vibrio vulnific...
WP_009845362 172 LQKMDNEAITALLAGASMF-VELDEMWVKRGDRYYLYKESVWNENATLAGLSFSLSSEGNSCFVQRGNVCWEIEDH-SEL 249 Vibrio
Q7ME74       157 LRAMDDETINALIAGSIMF-LDKDDLWLRRGDYYHVFDKSVWSTNVETAGLSLSVRADNASCFVQRGNICWDVEDH-SQI 234 Vibrio vulnific...
Q87HP3       166 LQNMDDDAINALIAGASMF-IEGKEMWLRRGDRYFVFSKDVWQENVANAGLSYTLASQSKSCFVKRGNICWDVEDH-SQI 243 Vibrio parahaem...
Q6LJF1       182 LSELSSQGVDALLSGYRAYiTEQSTLWLNNDSGWKAIDANQWQPLAHSMKLAIADNTAA-VCSFRYSNICLNVATP-APL 259 Photobacterium ...
WP_022560646 158 LNPLSQSGREALLSGYRAW-QEGDTLWLNSEQGWKAVSPVVWQPIARQLKLTLETKDN--QCALRYSNLCINDSPSvYQS 234 Vibrio nigripul...
WP_012600721 158 LENLTTQGREALLNGYRAW-QQGDVLWLSGEQGWKAIPLEVWKPIAEQQEVTLSGE----SCSFRYSNLCLSESSN-DNL 231 Vibrio tasmanie...
Q5E016       164 LQMMDDTAIRAIISGSDTI-IADDLLWLRKGSRYYLYPTELKNKYLENYQLEATLFKQGANCYVRNGNVCWQDQTD-SKT 241 Aliivibrio fisc...
CCO60911     164 LQRMDYIAMKALLSGSEML-ISENELWLRQGDEYLLYQESIWNPLLKELQIQASLYNGKGNCFVKSGNICWEVENH-SDL 241 Vibrio nigripul...
WP_014257313 173 LQSMNEDTMTALIAGAVMF-GDDTELWLRKGDEYYVFDEETWNRNASKAGLSFNIVTSDSTCFVQRGNICWDIEDH-SDL 250 Vibrio furnissii
Q9KM24       181 LQNMGEDAINALVSGASMF-GSGSDLWLRKGDIYYLFNEETWLTNANKAGLSYSLLSADNTCFIQRGNICWDVEDH-SDL 258 Vibrio cholerae
Q7MCR6       251 LYSGLVIGVLLAFGAAL-RSLWLRYQEGRERR 281 Vibrio vulnificus YJ016
WP_009845362 250 LQIAMFILVIANILLVLgWAVYRWNSKKQEMK 281 Vibrio
Q7ME74       235 LRFSMIVLVIANIMLVAgWAVYRWNSKRQELR 266 Vibrio vulnificus YJ016
Q87HP3       244 LRISMIILVIANILLVIgWAVYRWNSKREELR 275 Vibrio parahaemolyticus
Q6LJF1       260 LTRWILGFLALAIAFLItRNIYQRRQNAKERQ 291 Photobacterium profundum
WP_022560646 235 AIKVVAIGALIILTLLMlRNGYIIRQQNREKR 266 Vibrio nigripulchritudo
WP_012600721 232 IMKTLIFTLLFTLLSGLgRVLYLRTKQRKERQ 263 Vibrio tasmaniensis
Q5E016       242 LSYIVLFLVFINVCLAIgWGISQWNGKRREMR 273 Aliivibrio fischeri ES114
CCO60911     242 LLHVMIGLAVFNVALILgWAVTRWNSKRKEMK 273 Vibrio nigripulchritudo
WP_014257313 251 LRISMVALVIANILLVFgWSIYRWNSKRQDMK 282 Vibrio furnissii
Q9KM24       259 LRTSMIILVIANIFLVLgWSGYRWNSKRQEMR 290 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap