Conserved Protein Domain Family
SPAR_C

?
pfam11881: SPAR_C 
C-terminal domain of SPAR protein
This domain is found st the C-terminus of many spine-associated Rap GTPase-activating - SPAR - proteins in eukaryotes. This domain is found associated with pfam02145, pfam00595. The exact function is not known.
Statistics
?
PSSM-Id: 403176
View PSSM: pfam11881
Aligned: 25 rows
Threshold Bit Score: 183.403
Threshold Setting Gi: 405950417
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD32246       549 KQVDtNAKNVFGQPRLRASLRDLRSPRKNYKSTIEDDLKKLIVMDNLGPE-QERDTgspkrkwsyplfrsqpqaeraprn 627  house mouse
XP_008112027  1408 KQVDlSTKNVFGQPRLRASLRDLRSPRKTYKSSIEDDLKKLIIMDSSAVEqQERDL------------------------ 1463 green anole
11_pfamImport    1 KQIDlSSKNVFGQPRLRASLRDLRSPRKNYKSTIEDDLKKLIIMDNPMTE-QEKEIkehgltkr---------------- 63  
XP_011480836  1459 kQIDtNSKNVFGQPRLRASLRDLRSPRRTYKSTIEDDLKRLIIMDNPGET-PARDP------------------------ 1513 Japanese medaka
XP_005173729  1432 KQVDlNSKNVFGQPRLRASLRDLRSPRRSHKSTIEDDLKKLIIMDNPTES-PSRDA------------------------ 1486 zebrafish
AIC60493       249 YS---EMDVMSTATQHQTVVGDAVAET--QHVLSKEDFLKLMLPDSPLVEeGRRKFsfy--------------------- 302  synthetic co...
XP_006106293  1414 pglfaEMELMSPAAQHPTAAGEAGSET--QHVLSKEDFVKLMLPDSPFAEeGRRKFsfy--------------------- 1470 little brown...
XP_012819119  1315 chglyseeDMSASSLLQDTAIDTETEN--KHGLQKEDFLQMVLPDSPVGEeEKRKFsvf--------------------- 1371 tropical cla...
XP_031599785  1467 Q-VDtNSKNVFGQPRLRASLRDLRSPRRTYKSSIEDDLKKLIIMDNPGET-PQRDP------------------------ 1520 Oreochromis ...
CAF97435      1352 KHVDaNSKNVFGQPRLRASLRDLRSPRRTYKSTIEDDLKKLIIMDSPGDT-PQRDPvrnaseqpacd------------g 1418 spotted gree...
BAD32246       628 ylgshspktqSPQKSLQRTLSDESLCSGRREPSF-ASPAS-LEPGLPSDVLFTSTctfpsSTLPARRQHQHAHppsgaps 705  house mouse
XP_008112027  1464 ----------SPQKTLQRTLSDESLCSGRRDGTY-ASAYC-FEQPLASDVLFTSTyp--sSTLPVRKQQQQQH------- 1522 green anole
11_pfamImport   64 ---kcpflqqSPRKTLKRTQSDESICSGRRDASY-ANTAT-FEQSLHNDVLFTTAyp--sSTLPGRRPYQQQGvsrarfh 136 
XP_011480836  1514 ----------SPRRTLQRTFSDESLCSGRRDASF-ACSE---DQTSPTDVLFTC-------TLPTRKHGLSSHhfq---g 1569 Japanese medaka
XP_005173729  1487 ----------SPHRTLQRTFSDESLCSGRRDSSY-ASTALfEGQVPPCDLLFTCT-------LPTRRHGHNTNhgalmps 1548 zebrafish
AIC60493       303 -------gnlSPRRSLYRTLSDESICSNRRGSSFgSSRSSvLDQALPNDILFSTTpp-yhSTLPpra----------hpa 364  synthetic co...
XP_006106293  1471 -------gnlSPRRSLYRTLSDESMCGHRRGASLaSSRSCaLDHALPSDILFSSTpp-qrSTLPprt----------qpa 1532 little brown...
XP_012819119  1372 -------gslSPRRTLFRTLSDESVCSYRRGSSQaSSHSSiLDQALPNDILFSTTps-yhCTLPlh------------nq 1431 tropical cla...
XP_031599785  1521 ----------SPRRTLQRTFSDESLCSGRRDAGF-ASS---ENQTAPSDVLFTCT-------LPTRKHAGSSNhm---qs 1576 Oreochromis ...
CAF97435      1419 alssascpfqSPRRPLQRTFSDESLCSGRREASF-ASC---EDPGTPGDVLFTAT-------LPLRRHAVSNQiq----a 1483 spotted gree...
BAD32246       706 TTPATGngfpekKSAISASELSLADGRDR--PLRRLDPGMMPLPDTAAGLEWSSLVNAAKAYE----------------- 766  house mouse
XP_008112027  1523 QSPNNGnls-ekKSNISASELSLSDTRDK--SLRRIDPGLMPLPDTATGLEWSSLVSAAKAYE----------------- 1582 green anole
11_pfamImport  137 SN-------------ICVSELSLMDAREKa-PLRHIDPGMMPLPDTASGLEWSSLVNAAKAYE----------------- 185 
XP_011480836  1570 kkMP-----------LSASELSLTEMRDKvpSLRRLDPGLMPLPDTACGLEWSSLVSAAKAYE----------------- 1621 Japanese medaka
XP_005173729  1549 KKVP-----------LSASELSLTEVRDKvpPLRRLDPGLMPLPDTACGLEWSSLVNAAKAYE----------------- 1600 zebrafish
AIC60493       365 PSMGSL------RNEFWFSDGSLSD------KSKCADPGLMPLPDTATGLDWTHLVDAARAFE----------------- 415  synthetic co...
XP_006106293  1533 SGLGSL------RNEFWFSDGSLSD------KSKCADPGLMPLPDAGTGLDWSHLVDAARAFEgldadeelallyhhapy 1600 little brown...
XP_012819119  1432 PGMTNL------KNECWFSDQTLSD------KSKFNDPGLIPLPDTGARLNWSHLVDAARAFE----------------- 1482 tropical cla...
XP_031599785  1577 KKVP-----------LSASELSLTEVRDKlpPVRRLDPGMMPLPDTASGLEWSSLVNAAKAYE----------------- 1628 Oreochromis ...
CAF97435      1484 KKMP-----------LSASELSLTEVRDKvpPLRRLEPGLMPLPDTAGGLEWSSLVSAAKAYEaqravslfsltepqtgg 1552 spotted gree...
BAD32246       767 -VQRAVSLFSLNDPALSPEip-paHSPVHSHLSLERGPqTPRATPT--MSEESPLDLTGKVYQLEVMLK 831  house mouse
XP_008112027  1583 -VQRAVSLFSLNDAVLSPDip-saHSPVLGHLSLERQP-TPRTTPT--MSEEPSADLTGKVYQLEAMLK 1646 green anole
11_pfamImport  186 --GNAA-LFDAFACGSSPN-------TVPSYIDQLKKPaEVWMSSLtaAVEDPPSDLTGKVYQLEAMLK 244 
XP_011480836  1622 -AQRAISLFSLVEPQVVSPe----TRPVVSPV-QFQTPqTPRTTPTf-SSDEGSNNLSGRLNQLEVMLK 1683 Japanese medaka
XP_005173729  1601 -VQRAVSLFSLSESNAGSNelrpaISPVHFHT-----PqTPRTTPTf-SSEEVPNDLSGRLYHLEFMLK 1662 zebrafish
AIC60493       416 -DQRVASFCTLTDMQHGQD------LEGAQELPLCVDPgSGKEFMDttG-ERSPSPLTGKVNQLELILR 476  synthetic construct
XP_006106293  1601 lDQRVAAFCTLTDMQRAQG------LEGAPELPLCVEPg-GQEFLDarGMEPSPATLTGKVNQLELVLR 1662 little brown bat
XP_012819119  1483 -DQQ------LNAVQQGHG------CEESKESFLCSGSlNENKFSFppG-QTTPSTLTGKVNQLEVILR 1537 tropical clawed frog
XP_031599785  1629 -AQRAGSLFSLTDPQLGGPdtrpaASPVQFQT-----PqTPRTTPTl-SSDEVPNDLSGRLYHLEVMLK 1690 Oreochromis aureus
CAF97435      1553 adarpaaspvqfhtpqtprttptfgghvpsadrqvqpavcvqrrlnekqdkvvllaemanlrennqrlq 1621 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap