Conserved Protein Domain Family
DUF3398

?
pfam11878: DUF3398 
Domain of unknown function (DUF3398)
This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is about 100 amino acids in length.
Statistics
?
PSSM-Id: 403173
View PSSM: pfam11878
Aligned: 46 rows
Threshold Bit Score: 67.6643
Threshold Setting Gi: 156359424
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015793400   36 PFIVEPLDYEELINKMRTILQNDPQRELVLFPMDDFEAKNITRAMRTIRPVpyndheimIPSkliDTnILPVSLhVRQCI 115  two-spotted s...
XP_017949051   51 TEVVDPVEFEDYLITHPVSIDSGPLRDLYEFPTDDVEVLYVQRECRTMVSS--------VP----EE-NEMDSH-VKDCI 116  tropical claw...
XP_027318667   52 TEAVEPVDLEEYLSAHPMPVESGPLRDLFEFPSDDIEVVYXPRECRTLVSA--------VPE---ES--EMDPH-VRDCV 117  mallard
XP_023352306  103 TEVVEPLDLEEFLLNHPLDAEPGPLRDLMEFPADDLELVLQTRECRTTEPG--------IP----EE-GKLDAR-VRDAV 168  Tasmanian devil
EHB12949       38 TEVIEPLDFEDVLLSWPPDAEPGPLRDLVEFPADDLELLLQPRESRTTKPG--------VP----ED--GMDAQ-ARAAV 102  naked mole-rat
XP_017948180   54 SDVVEPLDFEEYLSSHPPDAECEAIRDLYDVPPDDIEILYEPRECRTIEPA--------AP----EE-GKLDAR-VREAL 119  tropical claw...
CAG12198       57 SEVVEPVDFEEYVSSHAPGVEPGPLRQLMEFPQDDLELLHLDKECITLEPR--------VPD---EE-DSLDPR-VRDAL 123  spotted green...
KTG38608       85 TEVVEPVDYEEYVSSHPPGAEPGPLRQLLEFPSDDLELLLQERECTTIEPP--------VP----EE-DSLDPR-VRDAL 150  common carp
XP_026535379   49 TEVVEPVDFEKYLSTHLPDAEPGPLGDLIEFPKDDLEVSHEPRDCRTLEPG--------VP----ED-GKQDAR-VRDAV 114  mainland tige...
TMS20086       50 TEAVEPVDFEEYLITHPPIVESGPLRDLIEFPPDDIEVIYTPRECRTVAQA--------VP----EE-GDTDPH-VRDCV 115  large yellow ...
XP_015793400  116 DGFLRDWSVIEFKYEKYSGSWTELP-KLprlnEEANLQDQVYEID 159  two-spotted spider mite
XP_017949051  117 RSYTEDWAIVNRKYHKLGTGFNPNTl-DkqkeRQKGLPKQVFESD 160  tropical clawed frog
XP_027318667  118 RSYTEDWAIVNRKYHKLGTGFNPNTlDKqk-eRQKGLPKQVFESD 161  mallard
XP_023352306  169 EIYTEDWVIVRRKYQNLSSSYSPNTs-ErhreRQKSLSRQVFEMD 212  Tasmanian devil
EHB12949      103 EMYTEDWVIVHRRYQHLSPAYSPTTa-DtqreRQKGLARQVFEQD 146  naked mole-rat
XP_017948180  120 KVYMHDWVLVQRRSQELSTAYSPITl-ErqrqLQRGLSRHLYEVD 163  tropical clawed frog
CAG12198      124 SVYTDDWLVIQRKYRHYSTTFTPHSs-ErqreRQRGLVKQTFELD 167  spotted green pufferfish
KTG38608      151 GVYTDDWLIIQRKYQRYSTTQTPHNs-ErqreKQKGLVKQTFELD 194  common carp
XP_026535379  115 QVYTEDWVIVKKKYQKLSTMYNAITa-ErqreRQKGLSRQVFELD 158  mainland tiger snake
TMS20086      116 RSYTEDWAVVNRKYHKLGTGFNPNTl-DkqkeRQKGLPKQVFEAD 159  large yellow croaker
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap