Conserved Protein Domain Family
DUF3389

?
pfam11869: DUF3389 
Protein of unknown function (DUF3389)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 80 amino acids in length.
Statistics
?
PSSM-Id: 403164
View PSSM: pfam11869
Aligned: 16 rows
Threshold Bit Score: 97.384
Threshold Setting Gi: 119767658
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MEB3         5 MVIEFSHGKIIVTPHEVVVRLQGGhsVTLSAQVDAVQLIGrGANVLVANGAECKWSIKLDSESQLIEISQQLGIAI 80  Vibrio vulnificus Y...
jgi:Sama_2023  1 MVISHSQGKLILAQTELLCRLNGG--VQLRALMDDIRLLA-DAKLLIADAGAVSWTLILDDDEQLDAIAAFYGLEK 73  Shewanella amazonen...
jgi:Shew_2138  1 MVIEFSGGRIIVSPQEVLVKLTTG--VSLYAMADDLRLLS-AGNIMVADAGAVRWHLSLDDANQLGDIAESLGVDI 73  Shewanella loihica ...
Q8EFH4         1 MVLDFSQGKLIATEFEVQIRLSVAn-VVLQASAEDVSLRL-DPPMIIANGGSVRWSMKLDNSDQLQSLQALLGIDY 74  Shewanella oneidensis
Q081A8         1 MVIDFSLGKIIVTVHEIQCRFHDSq-LVLAASVDDISCFH-QGLVIVADAGTVRWSLKLDNPAQLEVLLNHTGIHA 74  Shewanella frigidim...
BAJ02572       5 MIIDFSQGKVILSPFEAQVRFNTSg-ITMYAMVEDIKFID-DALIMHADAGAVRWSLKLDTPEQLALIREELGV-- 76  Shewanella violacea...
WP_004728152   1 MVIEFKSGKIIVTAHELVIRLQGEhhVTLQAQSDAVELIGrGANVVAVNGSEAKWSLKLDNEAQLRLLATELGCDI 76  Vibrio furnissii
WP_013344141   1 MILEFSQGKLIANAHELMVRLNGPgrITFQAAADAIELVG-IANVVTAFGGGISWSVQLDSADQLEALAEELGVKI 75  Ferrimonas balearica
Q5E0V1         1 MKISFSEGDIIANQREIVIRLSNKsrTTLQAEVDAITLIG-GANVINAVGSGAKWSVKLDDEVQLQQLAEEIGIAV 75  Aliivibrio fischeri...
ABM03232       1 MLIKFNQGRIIANNRDIMIKLEGDakVTLQAQVDEISLLG-GANVITALGSGLSWSLRLDNREQLDNLAAAVGIPI 75  Psychromonas ingrah...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap