Conserved Protein Domain Family
DUF3386

?
pfam11866: DUF3386 
Protein of unknown function (DUF3386)
This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are about 220 amino acids in length.
Statistics
?
PSSM-Id: 403162
View PSSM: pfam11866
Aligned: 48 rows
Threshold Bit Score: 212.052
Threshold Setting Gi: 502677715
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7V7C8                     11 APGSDCRELFQAAYENRYTWDPVFSGYRGRCLW----VKDDRVVEGKFELGADLKAHID---GIEDELIAKAVSSQLWEV 83  Pr...
WP_012913425               32 ddgQTAQSMMDAAHHGRATW-NNFTGFRAKIHA----QSSGQSVHGTLAVAADGKLELKlenAGENQENVAWIERTLRST 106 Pi...
Q2JJF8                      3 AQQAPARELFKEAFENRYTWDKDFPGYRAEITYfpkeGDSSLSFSGVVSIDRNMKIDVA---GVEDEEIRQKIREQMWEV 79  Sy...
dbpsupku:SYNPCC7002_A1858   2 TQTLTAQDAFRAAYENRYTWDQDFPGFTATVTF----THGDQSYTGTVAIKADMSFEVT---GIEAEAAKKEIEGQLWEI 74  Sy...
jgi:Cyast_1268              2 TQTLTAENLFRSAYENRYTWDSDFPGYSCDITL----KSKEGTFTAQAKIGADLKFEIS---GIEEGPVKKAMEQQLWEI 74  Cy...
jgi:Cyan10605_0001          2 TQTLTAEQLFRNAYENRYTWDENFPGYTCDITY----KTPTATYTAKGKIESNLQFSIS---DIEDSSAQKAIQQQLWEI 74  Cy...
jgi:UCYN_01710              3 kRTINARDLFRSAYENRYTWDANFPGYTASITF----RENDQVFSGQIKINKDLSSEVF---NIKDKEVLAQIKSQLWEI 75  Ca...
WP_009544261                3 ATTLDARDLFRAAYENRYTWDKNFPGYTADVTF----KNNDRTFTGQARVNGDMSTEVF---NIEDEEALNQVKSQLWET 75  Cr...
jgi:PCC8801_4427            2 IETMEAKDLFRAAYENRYTWNQNFPGYKADITY----NRGDQVFTGEVQVNQDLSAEVF---NIDDPDVKKEIHGQLWEI 74  Ri...
WP_015145858                2 TERIEARDLFRAAYENRYTWEKNFPGYTADVTF----RRGDEVFRGKVRVNPDLSGEVF---EVADEQAKKEIHGQLWET 74  Pl...
Q7V7C8                     84 AIHRVRRSFEKTHGENTFTAGENDEVG-LEVIVGGK--NLGDRYRIKNDVVTMVHRHIHGTVVTIFTKSTTDTGYG-YLS 159 Pr...
WP_012913425              107 INHRLSED----QGVTNVAFADNDTSHpMGRLVKSNdpAEKSLWRVQGDVLTEVIRNNEKTQMIISVSEVHRTADGkHLP 182 Pi...
Q2JJF8                     80 MVHRVRHSFDEEHGGHTFAYGEPQNSDiTEVLVSGL--SSTDRYWVQGKHIQMVHRHLANRTITVSVQEFYDTGEG-YLP 156 Sy...
dbpsupku:SYNPCC7002_A1858  75 TVHRVRRSFEDSHGKNSFEFGEKFADGaQEIQVTGA--SMGNSYKIKNNVVTFVNRKIRDIIVNINTFDVLNTDEG-YLS 151 Sy...
jgi:Cyast_1268             75 TIHRVNHSFEKSHGDNTFTFGEKDENGaVEILVGGA--SEGNRYKVKDNNVCFVYRRMGKGIVAINTFGLLNTDQG-YLS 151 Cy...
jgi:Cyan10605_0001         75 TIHRVNHSFEKSHGENTFSFGETDADGaVEILVGGA--SQGNKYKVKDNVVTLVYRKIRDIFVTINTFEVLHTDKG-YLS 151 Cy...
jgi:UCYN_01710             76 TIHRVRRSFEDTHGQNSFRYGSIDEKGlVEILMGGK--SEGDCYKLYDNKICHVHRHIQGIAITINTFNSHDTGEG-YLS 152 Ca...
WP_009544261               76 AIHRVRRSFEDVHGQNTFRYGDTDESGaVEILMGGK--SEGDRYKLRDNEVCHVHRHIHGVVVTIDTFSSHKTEDG-YLS 152 Cr...
jgi:PCC8801_4427           75 AIHRIRRSFEDTHGQNTFRYGKTDETGaIEILLGGK--SEGDSYKLRNNEVCHVHRHIHGVVVTIDTFSSHDTGEG-YLS 151 Ri...
WP_015145858               75 AIHRIRRTFEETHGKNTFSYGDTDETGaVEILVGGK--SQGDRYKVRNNEVCHVHRHIHGVVVTIDTFSSHDTGEG-YLS 151 Pl...
Q7V7C8                    160 HTYSSQYHDPKTNEPTSg-----LSQFTDTFVPLadDGLWVLS-ERLVKKDAfAGMAAEQHlFKFVDLEQL 224 Prochloroco...
WP_012913425              183 HAYVVTTTEQASSEAAApgavlsVRQVTSQWTTV--GHLDLPKqLTAVITKPgERRV--VEsITFSDHELL 249 Pirellula s...
Q2JJF8                    157 THYTAEYCSPGTGEKTQa-----KMIYEDRYQKI--GRYWILV-ERRIWEEQdGQKSSSPQlFLFSNIRFf 219 Synechococc...
dbpsupku:SYNPCC7002_A1858 152 LGYDSVYFDAATKEPKAg-----KSLFRDSFEKV--SGYYVLT-RREITYLE-NDQEVDKKvFTFTDIQf- 212 Synechococc...
jgi:Cyast_1268            152 TGYDSVYLDAETLQPRGp-----KTVFNDTFENV--DGYYVLT-NRTITTEE-NGAPVTTE-YQFSNVvlg 212 Cyanobacter...
jgi:Cyan10605_0001        152 LGYDSIYADAQTGEQKGa-----KSIFHDKFEKV--GDYYVLT-NRQIITEE-NEQPTITE-FSFSNIvfn 212 Cyanobacter...
jgi:UCYN_01710            153 HCYDSIYHDPKTGKIRTe-----KRDFEDNYHKV--KNYHILS-NRIIKGRE-DEKSLIKD-FSFSSIELL 213 Candidatus ...
WP_009544261              153 HRYDSVYHDPKTGELKAg-----KRYFEDNYEKV--GGYYILT-SRIITGEE-NGETVTQE-FGFSNIKLL 213 Crocosphaer...
jgi:PCC8801_4427          152 HRYDSIYHDPKTGEVKAp-----RSYFEDNYEKV--GDYYILT-SRVIETED-HGQKITKQ-FGFSNIQLL 212 Rippkaea or...
WP_015145858              152 HRYDSIYRDSKTGEVKAg-----RSEFEDNYEKI--GKYYILT-SRVIQTEE-NGQTVTRE-FGFSNVKLL 212 Pleurocapsa...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap