5HIU


Conserved Protein Domain Family
DUF3384

?
pfam11864: DUF3384 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3384)
This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is typically between 422 to 486 amino acids in length. This domain is found associated with pfam02145.
Statistics
?
PSSM-Id: 403160
View PSSM: pfam11864
Aligned: 82 rows
Threshold Bit Score: 179.764
Threshold Setting Gi: 388851488
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HIU_C                 36 LSERVLAANKLRFAVVDFPLNPVHAIWHAAKDMIHPE-N---PDNARQASWELLIECV-KYPNSTELERSEYFHTLTG-- 108  Chaet...
CCE82755               60 LSERASAAAHLAETLKKYSVPSSMEIWLLARDLVNKN-R---QTYIRRNGLELLIECIiSDRSSSVGNMLLYFNDIVSfc 135  Mille...
CCE43871               71 PPSQSQALEQLTESVERFSLSSIQEIWYLVRHFCDPR-Q---PRNIRRQAFKLCIACI-EKDDNSMGARTRYFSDVYKyt 145  Candi...
EAZ63706               58 LSVRTDTAAKLAESLDKYSISSIPELWYLARDMCDPR-M---SSSSRRVALTLLDKCI-KHDDDSVGARLRYFRDIVTfc 132  Schef...
XP_007373123           68 NTVKLTALIKLTESISKYSISSIPEIWYLVHDLCDGRkN---PTNIRRQALKLCIECIkSDDSKGVGAKLNYFNDIVKyc 144  Spath...
XP_002549571           65 NSTRLSALNKLTDSIYKYSISSVPEIWYLVHHYCEYN-NskySRDVRRAALKLLTACIkKDASSGIGSRIRYFNDINTyc 143  Candi...
EMG46989               61 NTTKLNCLQKLTESIEKYSISSLPEIWYLVHQYCEYTaN---TREIRKATLRLLNTCIkKEFDTGVGSRIRYFNDINKyc 137  Candi...
EEQ40372               56 LTSRASAASEITENIEKYSISSIPEVWYLARDLCDHK-A---QSSIRRVAVKLMIQCI-KHAEVAVSNKLMFFNDITTyc 130  Clavi...
XP_001482353           60 LPQRASAAEKIAKSLNEFAISSIPEIWYMVRDLCGPN-V---QLHIRRTGLRLMIRCIyADDADFVSNNLVFLKDLMKyc 135  Meyer...
LoveMIT:GQ68_00802T0   63 TQSRTEHLFKLYESIGSYSVSSIPEIWYLVKDLLGSN-N---PDDTRVAALNMLILCIk-lDESAISSTIMYYDDILRyc 137  Komag...
5HIU_C                109 ---P-Ahs-------kdFCYQLVALEQLTNHGRNIAGF-YYEMFPLlTLWLNQAYRaardarKl-aL--ARGATKNSSKG 173  Chaet...
CCE82755              136 disDnSid-------saFDLFLTALIKLTDDAREISNLiIYDKEWNlMKFLDSCL-----------SsmQSILSSSSRAS 197  Mille...
CCE43871              146 qftKhHfd-------peFTLILKALSTLCKEGHDIHDFiIFEDHRNlIRWFTKAVd------------tLVSVSNDDNRE 206  Candi...
EAZ63706              133 qlkPgSrid------peYDLFLVALKTLTNDGRDIHDFcIYDDEKNfNSLIDLSLFl-----LaplSkhYVYQDSLQDEK 201  Schef...
XP_007373123          145 rfkSgStsgnvsivdpdFDLFLQALVALSDNGRDIHDFvIYDDKHNlNVFLEDSLVg-----FkgvAgkYNFQSDDQDTE 219  Spath...
XP_002549571          144 mfqNnRtd-------pdYDLFLEALIALTNDGRDIHDFiIYEDRNNlNVFLENSLGe-----LiesSnkYHYEWDEKVED 211  Candi...
EMG46989              138 lfkEnTid-------pdFDLFMDALVTLTNDGRDIHDFiIYEDRSNlNIFLENSLRs-----VialSdnYKFQSDEKDEE 205  Candi...
EEQ40372              131 qlrEsSvd-------aeFDLFLNALRNLTDDGKDIHDLyIYDSSKNwRTFIIQSF-----------------SSLSKTQL 186  Clavi...
XP_001482353          136 lttDaRld-------peYDLFLQALKALTREGKEVNDFcVYDESKSfLRFFEASL-------------------AYFNKA 189  Meyer...
LoveMIT:GQ68_00802T0  138 tftPsGld-------rhFNLFLKALTTLTINGTDIHLLaTYEKKPL-GKFLSQAMa------------iVESSLRSASHK 197  Komag...
5HIU_C                174 KAPASPEDKNLSQLFALVKDVIKFNFKFATDDVIAGLIDMLLKICMLTSVEDDLRACIHVIESLVTFGSIPTNKLKYCIQ 253  Chaet...
CCE82755              198 TSEKDRVLKFDMDLIQFLIKCVISNQHSFKGPLIDSMIQTLISMCTDVSDADLLSLCLKFLHAVIRSGILNAKSLDSVLR 277  Mille...
CCE43871              207 IHHIDVQISNCVDLLHFLTNCLKFNHATLKD-FANANVSKLASL--QTTDASLLRAIVDFFNCITSFNKLKKENISQILK 283  Candi...
EAZ63706              202 ALSNDKEFSFLVLTLDFVKNCLKFNFTLLEESLVVTILNRAVEIGFQTTNKVILMNVLELTDSVILFGSIPIDCFNKVIN 281  Schef...
XP_007373123          220 LMHKDRDFRTLINLIEFVKNCLNFNYTLLEESFVNAMIYRLIRIGSKTSNLTILTSVVSSLNIIFSFGNPPIEYFSNIIQ 299  Spath...
XP_002549571          212 LKLKDKNFSNILRIIEFTTNCIKFNYATFNETTLVWIIRHLIR--TESNNKQILSAIIDCFNSVLIYGHAPVDCIPDTLR 289  Candi...
EMG46989              206 LMSKDKNFVNILNVLEFTKNCIKFNYATFNEQMVSWIIEKLGQ--TKSSNKLILTGIIDCFNSILMYGHFPYECIPQTIA 283  Candi...
EEQ40372              187 NSSDDSASRNLLTLVRYLKNCFKFNSNVIDEEMVSSIIRISLRVSESVQNTDLLSALLELIKIISMFGFVPQDMYYNVLI 266  Clavi...
XP_001482353          190 RSAEGAEAEQLLETLKFLQNCFRYNGHILDSNTINSLLLHILTCVLGPVADVVILEAIKAILALVESGAVITSVFSNLIS 269  Meyer...
LoveMIT:GQ68_00802T0  198 NESTENIDETLCQILVYITDCIKFNSNSFESFEIIHFLSQVITFTKITTNTSILERCLFFIETLSLYGVFPMDQLTSVIS 277  Komag...
5HIU_C                254 VLSSIHCLVPS-----LQKEAWHTISIIC-RSHHGQSTVRILLDFLRSYSPnpd------------------knREKDTV 309  Chaet...
CCE82755              278 FLCLKY----Das-enDNVFIWESIIHIS-REFGAQIAIIQLCDILKSAAEssinsatnl------knryenkrGNGPSE 345  Mille...
CCE43871              284 FLAFAHE---QstdpdIKKRALETIENMC-DESTSVFIGTTLCGQISDPSLk---------------------qLSNESH 338  Candi...
EAZ63706              282 FFSSVYGI--Sld-ddLNQTVWETIDSLC-KEDTFQLVITGLCDTISSHELqryrgs------------tttisEMNLLT 345  Schef...
XP_007373123          300 FLTSIYGS--Sid-erLNLLVWESIVSLC-LQDSIQLVVSTLCDFISNPDLqr-------------------srSDATAN 356  Spath...
XP_002549571          290 FLSIIYGS--Sid-teLNDLVWRCANNMY-AEDSVQIVIMSLCDNIANPELnpy------------------kvQSSEGR 347  Candi...
EMG46989              284 FLSQIYGS--Sld-qsLNLSIWQCTNNIC-TEDTFHIVIESLCDNIGNPDLk---------------------gSTNQGN 338  Candi...
EEQ40372              267 SLCRL-----SasaenLNELAWESIKSMYyNSPTT--VFNTMCQILQNPEFqqfeswdt-------lsstihdpSPKSSA 332  Clavi...
XP_001482353          270 VLCSC-----YnisadIDKVIWSTIHIIY-ATPMSIQLVYHVLTIINNPELrqfknqnipdihslrssdsrggaKTIKRD 343  Meyer...
LoveMIT:GQ68_00802T0  278 TLATVYTSEEEef-qeLRHKVIRILDTLIqNSQTTIPTIFAICELIHQTHF-----------------------VSEVNE 333  Komag...
5HIU_C                310 RDVR---GALSVLQKLLR--------KTAekGYP------QVPLSLLVGGLANVSKSSSTRVATEILRLINSLFHGREg- 371  Chaet...
CCE82755              346 NELRlscNIIRILHELNY----------N--LAQdesyiiDFSYFTILAACNVVLMLKNPKLTFTFLQSFNRMIAQDYms 413  Mille...
CCE43871              339 PAISiclGSLDLIELLRV-------------KIRlekikfEFPSFFYLSSLLHALQMKIPLIGKRVSKMLAAALDGSFyk 405  Candi...
EAZ63706              346 TSVNsciGAIELVQMLHVv------------NVThnrlsfESIYAGVLKASKTAISYNIPLINTTFLRSYDRLFSKESys 413  Schef...
XP_007373123          357 TAIYssiGAFQLIVKIQI-------------KNAiegnsmDSTYFKVIRALKSALSFNIPIINTSYLRNFDKLLAKESyl 423  Spath...
XP_002549571          348 KMLYaciGSIRLLRQFQAr------------ASCqkhnlfELALIDVLRAYKVALSSGISLINNEILDCFDKLFAKEAyp 415  Candi...
EMG46989              339 IPLScclGSIRLLRFFQAr------------VVTqkhnllELVFTRIINSYKIALATGIPQINSEVLDCFDKLFAKDAyr 406  Candi...
EEQ40372              333 ALQKsllGALDMLERILL-------------EAGtrsfatDYTSDLTITSLIDCMNQKVGVINTGILRMLDHLLADHEv- 398  Clavi...
XP_001482353          344 SPLTsclGAILILELIALt------------SCIedneriDSFHSEFYNNLKLALTHQVPVINTAILRMFDRIFSKAPie 411  Meyer...
LoveMIT:GQ68_00802T0  334 NVIV---GCLEFLKLLIMqeidgralNKH--RNDrlnmflDTSMSHLLESWEKSSEIPSLVVKVALLNFFLEILNTSSd- 407  Komag...
5HIU_C                372 ---------nINPILVEEHWEPI-------FDVAAQCATKAVTLPpadasasplptvakeepvvednvslqLKHLILRVE 435  Chaet...
CCE82755              414 is----sslpFETLMPFRLWYSNnlsifnvLSIVLLNSPECYQE---------------------------WSGLCDKLQ 462  Mille...
CCE43871              406 nylgrestglFNDIFPFQVWYSEgcsmfdiLDSIQVHDEEDEYL---------------------------MESICDSLK 458  Candi...
EAZ63706              414 inyniqfndsFDKILPFALWYSStlsvfdvLKGLRINTDQDKSY---------------------------MSSICLSLQ 466  Schef...
XP_007373123          424 dnfglkfqdsMDKILPFQLWYSSncsiydsLRKLKVNSDQDIDY---------------------------FQSICVSLQ 476  Spath...
XP_002549571          416 dnfditfngsMDKVFPFHLWYSTnsi-ydlLNLLQVNNDQEKGR---------------------------LQSICLSLQ 467  Candi...
EMG46989              407 dnfdidftdsIDKIFPFQLWHSTnsi-ydlLNLFQINNEQDENR---------------------------LQSMCLSLQ 458  Candi...
EEQ40372              399 ----------CDALFPFQSWYSSsrsifllLSSFRVQSEQESEY---------------------------WTSLCSSIF 441  Clavi...
XP_001482353          412 plinnvdhavVGKAFPFYFWHSQthslfdlLSVIRVTTEQDRSY---------------------------WKSMCISLQ 464  Meyer...
LoveMIT:GQ68_00802T0  408 ----------YYKIFGSMFWFNSdsslwrcFDNLVNFSYDEDDDDad-----------------------dYYRLVSSLL 454  Komag...
5HIU_C                436 NLIVh---qGPELLQRDDCMKflirvqhalP 463  Chaetomium thermophilum
CCE82755              463 VLFKt----HELIAPQDKLVDtflknheyiS 489  Millerozyma farinosa CBS 7064
CCE43871              459 NLYQs----HEMTVPKDKMLDffvkksshiS 485  Candida parapsilosis
EAZ63706              467 SLYEn----HELQSPKDKLVNflmlnyqylA 493  Scheffersomyces stipitis CBS 6054
XP_007373123          477 SLYEn----HELSTPKDKLIDffmayspylP 503  Spathaspora passalidarum NRRL Y-27907
XP_002549571          468 SLYEs----QELPTPKDKLIDfftnyieylP 494  Candida tropicalis MYA-3404
EMG46989              459 SLYEs----QELPTPKHKLVGffgnyikflP 485  Candida maltosa Xu316
EEQ40372              442 QHFDs----GSLLAPKSKIIDlfmrypdllP 468  Clavispora lusitaniae ATCC 42720
XP_001482353          465 LLYEd----HEISCPKERIVEffmekhnliL 491  Meyerozyma guilliermondii ATCC 6260
LoveMIT:GQ68_00802T0  455 SVLQrlsetGKVLGMKDNCMNffnnsfrrlS 485  Komagataella phaffii GS115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap