Conserved Protein Domain Family
DUF3377

?
pfam11857: DUF3377 
Domain of unknown function (DUF3377)
This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is about 70 amino acids in length.
Statistics
?
PSSM-Id: 403153
View PSSM: pfam11857
Aligned: 28 rows
Threshold Bit Score: 59.6378
Threshold Setting Gi: 71896245
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003437629 584 SREGREEETNEVDVVLKVDDSqERTMSILMVTI-PLVLVLCILGLIYAIINtLQSKGAPRLLVHCKRSLQDWV 655 Nile tilapia
AAI68432     579 AGREDPNTGRDVDVVVHIDEY-TRAVSVAMVIV-PLLLLLCILGLIYVIVQ-MHRKGPPKALRYCKRSLQEWV 648 tropical clawed frog
XP_027322516 582 YSEGGRKQGGDVDVVVQIDEY-TRTMSVVMVLV-LLVLLLCILGLIYVIVQ-MQRKGTPRMLLYCKRSLQEWV 651 mallard
XP_003416326 602 dfEAGEDQDGGSRVVVQMDEA-ARTVNVVEVLV-PLVLLLCLLGLTYALVQ-LQRKGAPRMLLYCKRSLQEWV 671 African savanna elephant
O54732       588 KEENAGDKDEGSRVVVQMEEV-VRTVNVVMVLV-PLLLLLCILGLAFALVQ-MQRKGAPRMLLYCKRSLQEWV 657 house mouse
ELK15435     201 EGDSGAGKDGGSRVVVQMEEV-TRTVNMVMVLVpPLLLLLFILGLTYALVQ-MQRKGAPRMLLYCKRSLQEWV 271 black flying fox
XP_015224061 580 dyKDEGEGNGDVDVVVKIDEY-TRTMNIIMVTV-PLILVLCILGLIFAIIK-MQRKGAPKLLVHCKRSLQDWV 649 spotted gar
XP_001924042 580 PEDDDVDEKKEVDVILRVNDNdKHIMTLILVIV-PLVLVLCILGVIYVIITtLQRKETPKVLVHCKRSLQQWV 651 zebrafish
XP_011474769 629 DAED--GEDKEKNLVIPVANNeSKVMTLIMVTV-PLVLILCILILIFAILRtLQNKEPPRALVHCKRSLQDWV 698 Japanese medaka
1_pfamImport   2 AEEE--EEDKELNVVVTVADDgSKVMTLIMVIV-PLVLILCVLVLIYTILRtLQNKETPRALVHCKRSLQDWV 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap