Conserved Protein Domain Family
DUF3373

?
pfam11853: DUF3373 
Protein of unknown function (DUF3373)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 472 to 574 amino acids in length.
Statistics
?
PSSM-Id: 371762
View PSSM: pfam11853
Aligned: 25 rows
Threshold Bit Score: 432.911
Threshold Setting Gi: 501884541
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013010954  221 DHNNSSLFTNRLRIRLNSRVNDKLSFAGRLVMNKVWSDASDVQWMDGSYKSM---YLDGNAGSVPTDD-KLHVERAYFVY 296 Denitrovibrio ...
WP_013450934  147 DTNNDFFMTNRLRVRMSSKVNENLSFTGRLVMYKAYGESISEHFFNGTMGSM---NMDMNSGQVPGDD-SIHVERAYFVY 222 Calditerrivibr...
WP_013886318  191 DSNNDVMFTNKLRLRLSSKINNNVSFNGRLTMYKAFGEATNIRFYNGNFNSM---HLDGNSAAVPTDD-SVHVERAYFVY 266 Flexistipes si...
ESQ09381      112 TLSNDALFTNRLRLSMNVKATEQVEFKGRLAMYKAWGMQSAF----NDASGTmwpVFDGNITRTPVSDsALYVDRAYVNW 187 uncultured Des...
jgi:UWK_01173 105 DVSNDTSWTNRFRLNMRVKATENVEFKARLAMYKAWGSQGNIYGSGSNGNGQifpNWDGNSTRTPSDN-ALRVDRAFVNW 183 Desulfocapsa s...
jgi:Saut_0398 134 KQENDAFMTNRLWLNMNWAATKNLSFTGQLAYNKAFGARSGASDPTNSSFE----TFDWIANENAYDD-TLRVRSAYFLY 208 Sulfurimonas a...
WP_011979737   74 SVGNDSLLSMRLWLNMAYAPDSHNVFKGQLSMNKAFGADFGTANNKTRALSMg-gMFDWTGNEALTDN-SLKVRQAYWLY 151 Sulfurovum sp....
WP_012663627  106 EKINNHIFTNRVILTGVYKPSDNLKATVRVEANNMFGSNDASNMMVNPFQ-----NVPWVANETPDDI-NFRLKEAFFNY 179 Nautilia profu...
WP_012083203   91 TSSWNGIFTNRLWLGMAFAPTSNLVFKGLISYYKMYGQLPAPQQGFN--------YFDWIVNETPNPSgELRLKEAYWLY 162 Nitratiruptor ...
Q7MSA6         94 KSKNDDFMSNRLILGMKYAPTDDLSFIGELSYNKAFGDTDNHAQSNTQPGYA---NFDWVTNENATDN-TVKVKQAYFLY 169 Wolinella succ...
WP_013010954  297 KNEi---GDLGWHFSFGRRPSTFGPG---KENseyATLGGSPLSHIIQWQFDGASLQFDFENLLEFLp-----GSFIKIC 365 Denitrovibrio ...
WP_013450934  223 SNNi---GPVPYHFSLGRRPAAYGAGmenHEN---AVLGGSPLGSIIQMNFDGASLGFDLEDVTGIP------GLNFKLC 290 Calditerrivibr...
WP_013886318  267 KNRl---GPVDWHFSFGRRPSTYGPPmgmHEN---AVQGGSPLAHIIQWNFDGGSLGFNYEKYFDTWd----lASMLKFC 336 Flexistipes si...
ESQ09381      188 NGI----GGAPIWLSIGRRPTTDGPPgqfRLGw-dEERFATPVAF-FDYPFDGFVLGYGYSWGNDALg-----TGKFRFC 256 uncultured Des...
jgi:UWK_01173 184 NNI----GGVPIWFSIGRRPTTDGPPaqvRMGa--DERMATPVSY-MDWPFDGISMGYAYRWGSEAMg-----TGRIRFC 251 Desulfocapsa s...
jgi:Saut_0398 209 KNDtfmgTDVPWTFSIGRRPSTNGHLvnlRDD----DHAASPMGHNINVEFDGLSSKFALENVTGVD------GMYVKFC 278 Sulfurimonas a...
WP_011979737  152 LGDkafgADIPWTFSIGRRPSTTGFLanlRED----DAAQSPLGHIINVEFDGLSSKLDLSNVTGVA------GMSFKVC 221 Sulfurovum sp....
WP_012663627  180 Y------FGDDLMFSAGRRPATNGYPanlREG----DDPASPLAHLINMEFDGFSFKIGNGEFSKITdkfgdwGTWLKFC 249 Nautilia profu...
WP_012083203  163 FGDsflgADIPWTASFGRRPATDGLLasyRED----QNPKSPLGHIINTEFDGASFKFNLENVTGVP------GMYFKLC 232 Nitratiruptor ...
Q7MSA6        170 KNDn---DTIPYTASVGRRPSVNGYPlnlREN----DQAASPNSHLINVEFDGASFKFDLDKITDIS------GMYFKIC 236 Wolinella succ...
WP_013010954  366 YGKGFESGWGSSNamaan-ngliASPEVDDVEFLGVIVKFYDDDQYKLWYNFARGFGVTDGFTGAAVMPFTVVGqntdls 444 Denitrovibrio ...
WP_013450934  291 YGQGFEGQYGTYNsl-------nSTADVNDVHFYGFILKAFDNDQYKLWYNYAYGAGITDGFVGTSVFPFFVRYggydns 363 Calditerrivibr...
WP_013886318  337 YGQGFEGQWGTANpf-------nAQADVNDVNMFGIIAKLAVNGKYELWYNWAHAYGVTDGFTGLVAMPFTVHGtdytld 409 Flexistipes si...
ESQ09381      257 FGRGFEAgl------------qqKNTGLDDTDFFGFNWDVLSKDVRLLNLQSFMAFNVFNYPNFQDPIINEAFG------ 318 uncultured Des...
jgi:UWK_01173 252 YGRGFEDgie-----------ldTANVMDDMDFAGFSWDVMKKGNRFINLQSFLAMNVFNYPQFQDPVIDQMAG------ 314 Desulfocapsa s...
jgi:Saut_0398 279 AGRGMSNAAPRFNsapy---adtTSNSA--IDLVGLIFTPWSDGQYTINSQYYYAGNLIDVKNS---------------- 337 Sulfurimonas a...
WP_011979737  222 LGYGATNAEPLFTgptp---yadTENNLDDIKLGGFIFEPYNDGQFIVKATWFKAWDLPGQQSPmn-------------- 284 Sulfurovum sp....
WP_012663627  250 AGRGYSSATGKWPsnfa--apysRNDALKNMDFAGFIFVPYDDGQYSLWTETVWAWHVQGYTMNYDATVALADPtkavy- 326 Nautilia profu...
WP_012083203  233 MGRGMTNANTRYAfgtlpdasytKVNGWSNTDLAGFIFVPYDDGQYSVHTTAFKAFNLPGYFASQYVWDATLnty----- 307 Nitratiruptor ...
Q7MSA6        237 LGRGLTNAKQRFSmdgtd-yaqnNREDSKHVDMYGFVFVPYDDGQYHVLTNFAWAKDMIGYDQAGMNAYQGAYMawmmap 315 Wolinella succ...
WP_013010954  445 adg-sydeyqitpNYSGSSSRLEaTAEVGDMEWHSLLAQGETFG---------FSWFTSFAMSKSHPDGR-------SRS 507 Denitrovibrio ...
WP_013450934  364 sn----mtyvmvpNYGGYISRIEpTSKVGDIELHSVMAQGKTFG---------FDWFAAYSLSKTHPDGS-------SAN 423 Calditerrivibr...
WP_013886318  410 gk---ydeytlepNYSGYVSRFEpMSKIGDLDMHTVLFQAENFG---------FKWFVSGAMSKSNPDGR-------SEN 470 Flexistipes si...
ESQ09381      319 ----------------EMSGFGE-RQQLGNIWHTDMVYQDKis---------sLNYFISAGWSQTQPNSNgi---fnDFA 369 uncultured Des...
jgi:UWK_01173 315 -------------LPQDQGGFGP-RVNVGNILHTTGVYQDKfg---------pVNIFAAAGWSQTDPDSSgm---fnDYV 368 Desulfocapsa s...
jgi:Saut_0398 338 ------------------NDQSQgFKTVGNLHAITANFVANGIGdgindflddTVFFISGAMSITDPDNG---------- 389 Sulfurimonas a...
WP_011979737  285 ------------pEFD------GnFHQFGDMQGAALSVLVDGLTedgy--fadAKVFGSFAWSKSMPFAG---------- 334 Sulfurovum sp....
WP_012663627  327 -----------------------emsdTGNYFGENVMLKADGIGdgisdflddTKAFVSFAYSKVKGNGK---------- 373 Nautilia profu...
WP_012083203  308 -----------mpDFTSFGLVQG-----GDMYGAAVSFLAQGIGdgindflddTNAFVSFAWSKTLPGGThvgtfngGPY 371 Nitratiruptor ...
Q7MSA6        316 tssnyydmiyktpQFK----------SVGDWNGGAITLGADGIGedwgdfmdeTKAFVSWAFTKTKPQNG---------- 375 Wolinella succ...
WP_013010954  508 AMYQFMDMDRMLGSKd--------SKTGTSVWVGVATPe-IPLTGGKFGFEYNQGSKYWVSMTAAEDDlvgSKLAVRGKV 578 Denitrovibrio ...
WP_013450934  424 AMYQFMGQDKLLDGK---------SRTGQSIWVGVMTPe-LPYTKGKLGVEYNWGSKYWLPFMATIDS---AKLATRGQV 490 Calditerrivibr...
WP_013886318  471 AMFQFMGQDKMVd-----------DTPGYSFWAGIMTPe-LPFTNGKLGFEYNHGSKYWTSMTAGEDAlvgSKIATRGDV 538 Flexistipes si...
ESQ09381      370 AMAAGMTGPNEs------------NENGYAVYAGIRYD--LDESNLKFGAEWNYGSQYWISFTPGHDDiymAKLATRGNV 435 uncultured Des...
jgi:UWK_01173 369 GMMMGMTGPNTe------------SENGYSTFVGARYD--IDEIGLKLGLEWNWGSEHWIAMTGGHDDlyqSKLAARGNV 434 Desulfocapsa s...
jgi:Saut_0398 390 --------QSMLGSTe--------AQNGYSEWVGVQYPs-LISEEGRWGLEYNHGSKYWRSITYGEDTnigSKLAARGDA 452 Sulfurimonas a...
WP_011979737  335 --------QMMMGSPd--------DETGTSWWIGANLPvgEGAEYGTFGAEYNHGSQYWRPFTYAEDTmigSKVAARGDA 398 Sulfurovum sp....
WP_012663627  374 ----------LLGQDstgnpvyegTHSGHSVWVGADMP--GFKDGDRFGLSYVKGSKYWRSFTYGEDTlagSIAAVRGKA 441 Nautilia profu...
WP_012083203  372 NGVTTNVPNAMLGSTd--------NKSGTSIYVGANFPv-PMIDGSRMGLEYNHGSKYWRSFTYAEDTlagSKLAARGDA 442 Nitratiruptor ...
Q7MSA6        376 --------YTMLGSTe--------SQTGHSWYAGIQVPa-LVTEKGRIGVEWNKGSKYWRPVTYGEDTvigSKLAARGTA 438 Wolinella succ...
WP_013010954  579 YDVYYHQPIVG-DRLF------ATIGYQHFDYEYTGSGSYLGA----PKKI---EDATAFD------------------- 625 Denitrovibrio ...
WP_013450934  491 YEAYYHQPIVG-DNLF------ATLGVMYTDYKYTGSGSPMGA----PIKI---EDVIPYN------------------- 537 Calditerrivibr...
WP_013886318  539 YEVYYHQPIAG-DNFF------ATLGYMHYDYEYTNSGSPIGQ----PKKI---EDATAFD------------------- 585 Flexistipes si...
ESQ09381      436 FELYTIWDIPAgEAISkygrafIRLGWQHYNYNYAGSGDWNMY----PYDLgsgSDLQMLQm------------------ 493 uncultured Des...
jgi:UWK_01173 435 YEIYGIYDLPTgEAISkyaktfIRFGYQRYEYDYSGSMDWNMK----PYDLddaADVMALGm------------------ 492 Desulfocapsa s...
jgi:Saut_0398 453 YEAYFTEPLID-DILS------LQIRYTYIDYKYAGSNGFFGStsgnAMSI---NEAIAa-------------------- 502 Sulfurimonas a...
WP_011979737  399 WEAYYTYQIN--DALS------LQARYTDISYDYTGSNGFFGNysgaSIKI---DDIKAGAagfdqmaaagviqhqdpag 467 Sulfurovum sp....
WP_012663627  442 VDVYYNTEIV--PHLT------AGLRYTYIKYDHAGSDGFFGMma-dPDVA---DNF----------------------- 486 Nautilia profu...
WP_012083203  443 YEIWFNKELIG-RTLT------AQVRYTYIDYKYSGSQSFFGEgg-nPMTM---NDIRGLQml----------------- 494 Nitratiruptor ...
Q7MSA6        439 WEVYYIQPLIGkDTLT------MDLRFTQIKYDYTGSNAFFGYeg-mPLSI---DEAKAAYaa----------------- 491 Wolinella succ...
WP_013010954  626 -----------------------TMMAVTDKVDKVYASFTYRY 645 Denitrovibrio acetiphilus
WP_013450934  538 -----------------------VMMPAVDKVTDFYLKMTYRY 557 Calditerrivibrio nitroreducens
WP_013886318  586 -----------------------TMVPVVDKVDQWYLQATYRY 605 Flexistipes sinusarabici
ESQ09381      494 -----------------------MGMDPVESADQIYLTFEAFF 513 uncultured Desulfofustis sp. PB-SRB1
jgi:UWK_01173 493 -----------------------MGLDPVESADQIYLTFEAYF 512 Desulfocapsa sulfexigens DSM 10523
jgi:Saut_0398 503 ----------------------gNGSKVVDKAQDIRFYLRYRY 523 Sulfurimonas autotrophica DSM 16294
WP_011979737  468 iigdlmgagltqaqaqgmlmakgMSSQVVEKAQDFRIYLRYRF 510 Sulfurovum sp. NBC37-1
WP_012663627  487 --------------------------SYVKKATDIRAYIRYKF 503 Nautilia profundicola
WP_012083203  495 ----------------------gYPVNAVDKAQDLRLYVRYRY 515 Nitratiruptor sp. SB155-2
Q7MSA6        492 ----------------------gMGSDVVEKASDIRVAFRYRY 512 Wolinella succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap