Conserved Protein Domain Family
Wzy_C_2

?
pfam11846: Wzy_C_2 
Virulence factor membrane-bound polymerase, C-terminal
Wzy is a membrane-bound polymerase of 12 TMs, found in Gram-positive bacteria such as Streptococcus pnuemoniae. It forms part of the EPS or exopolysaccharide system. This family is the 6xTMs at the C-terminal end of the molecule. Wzy functions in polymerizing the oligosaccharide repeat subunits to form high-molecular-weight capsular polysaccharides. A contiguous emebrane-bound flippase, Wzx, pfam01943, transports the repeat units to the external surface of the membrane. These polysaccharides form the capsule and their differing compositions contribute to the multidudinous pneumococcal capsular serotypes, all being structurally and antigenically different.
Statistics
?
PSSM-Id: 403144
View PSSM: pfam11846
Aligned: 28 rows
Threshold Bit Score: 124.374
Threshold Setting Gi: 302580253
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5E811          394 LLALIAPIFIHSQLEYPFYHSMIHWFTFIILlFWIDQlsck---------ykkYRISDISKITLRVSSLVLPIVTGFYML 464 Aliivibrio f...
WP_011768789    369 LSTLVIPIAVHTQTEYPFYHSALHWLVLLVLvFYIDSqsen---------srqKMFR--PTFALRAVALLTPLFTTLFML 437 Psychromonas...
Q6LM81          388 LVGLFFPIVLHTQLEYPFYHSLAHWVIFIILiYWVDNltak---------ynkHEMRYV--MTIKSLALIMPIVISGFML 456 Photobacteri...
WP_014205870    389 MFALLLPMVLHSQLEYPFYHSAIHWITFVILlFWIDQrvak---------yrfARFSKISKSALRITSLLLPFLTAVYML 459 Vibrio furni...
Q9KUW6          392 MLALFVPITLHAQLEYPFYHSAIHWITFIILiYWVDQrvar---------yrlASFTTLTKSLLRITSLVLPIVTSLYMV 462 Vibrio cholerae
Q7MHB4          388 MFALFVPIVLHSQLEYPFYHSAAHWLIFIILiYWVDQrvak---------vksVNFSRISKTALRIASLVVPILTTFYML 458 Vibrio vulni...
CAV17328        389 LLALFIPILLHSQLEYPFYHSAIHWITFIILiYWVDQrtsr---------hyqQPFSIVSKTLFRVSSLVVPILVSFYML 459 Vibrio tasma...
Q87L99          391 LLALFIPIVLHSQLEYPFYHSLVHWLIFIILlYWVDQrvsr---------yrqVGFSKVTKSLLRVFSLVIPAVFTFYMV 461 Vibrio parah...
RtaDB:Rta_37830 267 AWGVLGVIALHSLLEYPLWYGPFQFATLLAL-VLLGRp---------------EAAGAQTPPQARVVALVLAAGMAAGLA 330 Ramlibacter ...
jgi:Pnap_3942   311 AWGVLAVIGLHSLLEYPLWYGPFQIAAGLSA-WLLLSggrenqplpdadvdglNEKFKQKKPFAQYLRALAAITMIVMLA 389 Polaromonas ...
Q5E811          465 STLHTNWVLTQFETTKPMNPDILSRVTNPVVWEDRFNWDVLSTQLKIGIINKKPELIKPYIEWSQELIKTKPRPAFYQNL 544 Aliivibrio f...
WP_011768789    438 SNLHTISKITAYERNEKPNIQLLLDVVNPLVFADRFEFHLNNFRLRLASQMDQPEDLQKIIDSTEKTIESKPKAFFYTIL 517 Psychromonas...
Q6LM81          457 TTLYSGWLLTKFETTRPVNIDYLMQVNNPWAWQNRFDWDLHLTQLQLGTASNNPALIEEYIQWATKKAVDWPRPALYHNL 536 Photobacteri...
WP_014205870    460 SALHTNYILMKFEGSHPKNPELLNQVTNPVVWQDRYDWDVYSTYLNIGLYSQQPQYIQPYIDWSLAIIKHKPRPAFYSNL 539 Vibrio furni...
Q9KUW6          463 TALHTNYVLTQFEKSQPLNPELLKNVTNPLVWQDRFDWDIYSTYLNIGLHEQKAELIQPYIDWSLQIIQHKPRPAFYSNL 542 Vibrio cholerae
Q7MHB4          459 SALHTNYVLTKFETTRPVNPDLLQRVTNPVVWKDRFDWDVYSTYLNIGLATQDAKLIQPYIDWSLDIIKTKPRPAFYSNL 538 Vibrio vulni...
CAV17328        460 SALHTNYVLTKFEMSKPKNPDILKQVTNPVVWKDRYDWDVYSTFLNIGLYKADPSLIQPYIEWSLEIIKSKPRPAFYSNL 539 Vibrio tasma...
Q87L99          462 SALHTNYILTKFETTRLTNPDILNQVSNPVVWKDRFDWDVYSTFLNIGLYKQDPSLIQPYIDWSLQIIKDKPRPAFYNNL 541 Vibrio parah...
RtaDB:Rta_37830 331 WAGAAYGRVSQAYLTPEARRPAYRADPLRDVRP--GPFGGHAAFARLSLTPLGRASAVQVYGLALRLLHFSPEPKVIEAA 408 Ramlibacter ...
jgi:Pnap_3942   390 CVAISYHRVSQIYLLPDKRSAAYREDTLDKVRGS-RLFRNQARFAELSMTPLTPANAAAVYGLAKDMLHYSPEPRVIEKV 468 Polaromonas ...
Q5E811          545 IIAYQALGDEKRAEDIRREAIFLFPKSKFESVQLDKKL 582 Aliivibrio fischeri ES114
WP_011768789    518 YFAYLNNQQPEKAQKTLDYALYLYPEDHQLANIDKQTS 555 Psychromonas ingrahamii
Q6LM81          537 ISAYQLLGKPERASQIKQEAEYLFPGSDFATSEAQtal 574 Photobacterium profundum
WP_014205870    540 ILAYQGLGDHSRAEQIRAEAEFLFPRQDFTTVHYEPPS 577 Vibrio furnissii
Q9KUW6          543 ILAYQGLGDTSRAQQIRREAEFLFPNQDFSTVQYHPSI 580 Vibrio cholerae
Q7MHB4          539 ILAYQGLGDLSKAEQVKAEAEFLFPKNDFSNIHYQPPS 576 Vibrio vulnificus YJ016
CAV17328        540 ILAYQGLGDHSKAEQIRSEASFLFPNRDFSKVQYKKIS 577 Vibrio tasmaniensis LGP32
Q87L99          542 ILAYQGLDDSSKAEQIRAEAQFLFPNIDFSQVNYQPPS 579 Vibrio parahaemolyticus
RtaDB:Rta_37830 409 IESAVLLGQDEEAMWHLARYRAAFPAEHAAW---ARRN 443 Ramlibacter tataouinensis TTB310
jgi:Pnap_3942   469 IESAVMLGRDDEALQYLARYRAAFPQDHARW---ASKN 503 Polaromonas naphthalenivorans CJ2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap