Conserved Protein Domain Family
DUF3355

?
pfam11835: DUF3355 
Domain of unknown function (DUF3355)
This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is typically between 111 to 177 amino acids in length.
Statistics
?
PSSM-Id: 371753
View PSSM: pfam11835
Aligned: 10 rows
Threshold Bit Score: 126.81
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEC73148      55 MPSWLGAGAGIALRVQVSRVLYPVTGEVLHQVYNGYGAVAVQVLATSCWGVEALVWFRSSCDAERARSDTNERNIYDGCC 134 long-grained rice
1_pfamImport   1 MQSQLGGDSSSVLCVVVSHVLYLVTDEVLSQVYNAYGAVAVQVLATNSLDVKALVLFRSSCDAVRARSATNGRNIYDDCC 80 
8_pfamImport   1 MPSWLGGDSGAVLHVTVSHTLYPVTSEVLRQVYDTYGAVAVQVLAVSTWQVKALVSFISNHDAERARSATHGRNIYDRGC 80 
5_pfamImport   1 MSSQLGGDSSAVLRVTMSHIHYPVTSEVLHQVYDAYGAVAGQVLAMSDWHVEALMSFMSGHDAERVRSATHVRNIYDGCC 80 
2_pfamImport   1 MPDCLGGDSGAVLCITVSHIFYPVTTEVLHQVYDSYGAATVQILATSTWHVEALVSFMSSQDAERARSATQGRNIYDGCC 80 
6_pfamImport   1 MPSKLGGDATTALHVQVSHLIYPVTGEVLHQVYDPYGALEVHILVTDTWHAEAVVWFLASCDVERARAASHGRNIYDGGC 80 
7_pfamImport   1 MPSRLGGGIGDVLRVPVSHVLYPVTCEVLHQVYDIYGAEEVHMLVVHACWVEAVVWFWVSCDAERAQVATHGCNIYDGGC 80 
EEC78852      57 MPSWLGAGAGAALHVQVSHIIYPVTNKVLYQVYDIYGAEELHILVVDAWRVEVLVWFRARGDAKKARGATHGRNIYDGGC 136 long-grained rice
EEC73904      31 mstcargdsaaVLRVTVSQIIYPVTYEVLHQVYDTYGAVAVQVLAVSTWQVKALVSFMSSHDVERARSATHGRDIYDGGC 110 long-grained rice
EEE57948     146 MSTCPRGDSAAVLRVTVSQIIYPVTSEVLHQVYNTYGAVAVQVLAVSTWQVKALVSFMSSHDAERARSATHGRDIYDGGC 225 Japanese rice
EEC73148     135 LLDVQHTQS 143 long-grained rice
1_pfamImport  81 LLDAQHVQP 89 
8_pfamImport  81 LLDVQHIQI 89 
5_pfamImport  81 QLGIQYTQS 89 
2_pfamImport  81 QLDIQYAHP 89 
6_pfamImport  81 LLDAQQSQP 89 
7_pfamImport  81 LLDVQHAQP 89 
EEC78852     137 LLEAQHAQP 145 long-grained rice
EEC73904     111 LLDVQHVQM 119 long-grained rice
EEE57948     226 LMDVQHVQM 234 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap