Conserved Protein Domain Family
DUF3324

?
pfam11797: DUF3324 
Protein of unknown function C-terminal (DUF3324)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 403104
View PSSM: pfam11797
Aligned: 73 rows
Threshold Bit Score: 99.1867
Threshold Setting Gi: 122266185
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CFA4                 28 SKGLSIQNKYAYVVALLMQQNK--N-TVAPDLKLNSVEPSQVNYRNVINANLQNPMAGYLNQMYVQAEVKGLSNSKLSYK 104 Lactoc...
Q832H5                168 QKKSGLTPQYARVIAIMLTEDEe-PfNQGAMLHLKKASLQLANGQKVIAARIQNDQPKVLQELTIQGEIRLKGEKKILYK 246 Entero...
Q82ZS8                166 gKSTGLTSRYGFNVAIALRMSEdtPmYLAETLQLVKLVPTIALGNKSVQAVIQNPTSAIFPEVRLEGKVTKKGETKEYAK 245 Entero...
Q836D8                163 NQTTGLTSRYGFNVAIAMRSAAnvPlTEVNQLKLAKVTPTIALGAKSLKAVIQNPYAAIFPEVRLEGQVIKKGSSKKIAQ 242 Entero...
Prjna32935:ECBG_00562 158 aEETSLTSTYKIVQGVRLRQQL--DaLPDPELSLIKSEAVEKDGIASLKSRIENDQPVAFGKIAVKTVIREQDSDSVVGG 235 Entero...
EQC80224              159 eaDASLESNYQLQLGVRMRQSL--QeLPKPDLKLVETKAVEKNGKPTLKSSISNIRPVAFGNISVNTTIRDKNQ-AIVGG 235 Entero...
Q38Z67                164 DNHSNVSGSYAYNMGIVLRGKP--Y-EIYPELKYQGVNPTVRNGHPALGIQLNNTKPMAIKNAKVKAVVYKNGFFKDKRV 240 Lactob...
Q9X336                174 glNFSVHNRIEYAVAIQLNSEEteNsVNKAPLKLNGTTVESYPTQPQVHALFQNTNANIVRDVAVYYEVLSQDN--VLFH 251 Bacill...
WP_012727223          156 pEQVGVQNQYEYVIGVKLTTT---TkQVVYEPKWESVSVNTNHYYPHVAFQIANQTGSISGQVDLEMRVKSEEGKTM--- 229 Exiguo...
WP_003643000          167 TKGATLTSEYAYNVGIKLTSNR----DPLPKLRLADVQLKKRSGIKTVIGNIQNYHASILGKGTVTAYVSKAGQTKKLAV 242 Lactob...
Q9CFA4                105 ANKEMLQMAP--NSNFDYPVSIgDGNK--LEAGKYRLSMT-VYGQknndgkftyvdskgkeqkfDYQWKFTKDFTILGKT 179 Lactoc...
Q832H5                247 HKMEKFSVAP--NSNFDFNIPI-GLNT--FKPGTYHFTGK-ATGD-------------------GRTWKWEKEFKVGEAQ 301 Entero...
Q82ZS8                246 RILPSVRFAP--NSTMNFHLDF-GKED--VRPGTYIFEGK-AVLKed----------------eQQVWPFKQEFTISSQE 303 Entero...
Q836D8                243 RTLKNVRFAP--NSSMNFHLDL-GKQP--LDAGTYIFTGR-AILQqd----------------eQQSWPFQQEFTINTRE 300 Entero...
Prjna32935:ECBG_00562 236 FTAESFQFGP--NSTLDLYSAF-DEEI--VEPGTYHIQIE-LSAP-------------------RGTWVFEDSVTVSRPE 290 Entero...
EQC80224              236 FKSENFQFAQ--NSVLDLYSEF-EQEE--LKPGTYTIRIE-LSSQ-------------------RGTWVFDDKVVIDRQA 290 Entero...
Q38Z67                241 YETDSVDVAP--NSQWTVPISW-AFDR--LKPGRYNISIS-VKGNsyw-------------nqlPMSWHFRKKITINQQQ 301 Lactob...
Q9X336                252 GNIPAFNVAP--KSKVGLAIPW-KAKE--YKDGKYMLKVK-IKEN-------------------GVSKTYTEEFQITASN 306 Bacill...
WP_012727223          230 SHRMEARMAPytNTGFRFPITE----R--LAPGTYQVFVE-MRERe-----------------tNRTWSFTDSFKVTDEE 285 Exiguo...
WP_003643000          243 ADLKSSSMAP--NSNFDLPLKW-RTNRgiILPGTYTLYVKyRTTDekf--------------akPHVWSLKQDFVVGATD 305 Lactob...
Q9CFA4                180 ASKLNS 185 Lactococcus lactis subsp. lactis
Q832H5                302 AKKVNQ 307 Enterococcus faecalis
Q82ZS8                304 AKKLNK 309 Enterococcus faecalis
Q836D8                301 AKKLNQ 306 Enterococcus faecalis
Prjna32935:ECBG_00562 291 AETINR 296 Enterococcus casseliflavus EC20
EQC80224              291 AKAVNR 296 Enterococcus sp. HSIEG1
Q38Z67                302 ADKINQ 307 Lactobacillus sakei subsp. sakei 23K
Q9X336                307 VTKYAE 312 Bacillus anthracis
WP_012727223          286 AAHIQE 291 Exiguobacterium sp. AT1b
WP_003643000          306 A--VNV 309 Lactobacillus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap