Conserved Protein Domain Family
ATG22

?
pfam11700: ATG22 
Vacuole effluxer Atg22 like
Autophagy is a major survival survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions. Atg22, Avt3 and Avt4 are partially redundant vacuolar effluxes, which mediate the efflux of leucine and other amino acids resulting from autophagy. This family also includes other transporter proteins.
Statistics
?
PSSM-Id: 371676
View PSSM: pfam11700
Aligned: 35 rows
Threshold Bit Score: 326.144
Threshold Setting Gi: 145304208
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0U103        72 TSNKELSGFYMYGWAAEVFVVCGIGSFIPVTLEQLAR---ENGVLLSDRTTPCKAPRPitpsfsassfeallrpnpekgQ 148 Parastagonospor...
XP_011389368  59 TGRYELWSFYIYYIGNCGLGPF---NFAPSQFQNLLS---QQATNL--GAGQCGQDGQn--------------------D 110 Ustilago maydis...
Q0TYS2        43 TTRKEIWSYYSYYVGDNGLTLF---NFGPTAFQNLMYq--AAGD-----------------------------------A 82  Parastagonospor...
Q0CF56        43 ATKWEIWAYYSF------FYLLTDIDFAPTAFQNLLYq--AAGD-----------------------------------A 79  Aspergillus ter...
Q0CXZ2        50 TTKWEIWAY--YAWVNNHFG--------PTAFQNLLSqaaGSGG------------------------------------ 83  Aspergillus ter...
EAW12453      43 NSKRALWGYLVLCFSTGPTSSM-VNNYVTAAILSAAN---LLGH-EEGSNKPCPRRGTn-------------------iS 98  Aspergillus cla...
Q5A6K2        39 NKKSIFHTWLLLCYSTGPVASM-SRTYIPASIQSIAK---NVGK--TKMNQPCGTQGN---------------------D 91  Candida albican...
XP_001382475  32 AKKSIYRAWLLLCYSTGPVASM-SRTYVPAVIQSIAT---EVG--RNSKGGRCERRGN---------------------D 84  Scheffersomyces...
Q75EJ9        58 RGRWVFPAWLLVCFSTGPTYVM-MRSFVPASLQTIAH---ELGHPKGHPAAHCRPRGD---------------------D 112 Eremothecium go...
XP_001804907  44 ATKRALIAWLVLCFSTGPTAGMAF-RYVPAVLQSAAN---VLGH-IPGTNKPCAKRGVi--------------------R 98  Parastagonospor...
Q0U103       149 CVVHILGIEINTASFAMYTFSISVLIQALLIISMSGAADHGEIQENIPLVFAFVGSIATMLFLPV-VPKVY---LLGAVL 224 Parastagonospor...
XP_011389368 111 CRLLFAGKQRTVESIVLLSNGISFAIQAFLFLAIGSFADYGKKRPYILIVCTVVAIAISFAWLGVtKPQQW---QLATGL 187 Ustilago maydis...
Q0TYS2        83 EALEFLGRTRSINSIVLLSNGISFALQVVVFLILGSFADFGSWRPNILICLSIIAFGIGFGWLGVhTEEKW---HVGVGL 159 Parastagonospor...
Q0CF56        80 DGLVFAGKRRSVDSIVLLCNGISFSIQILVFLVIGSFADLGNWRPNILIVFSVIAYAVGFAWLGVhTEDKW---RTGVGL 156 Aspergillus ter...
Q0CXZ2        84 -TLVFVGRSRSVESIVLLCNGISFAAQVAVFLVIGSFADFGTWRPNILITLSLVAYGIGFGWLGVhTPDKW---HVGVGL 159 Aspergillus ter...
EAW12453      99 CLVKFGPGEIDYNSYTLYLRAISRATEGVVSIVTAGIADYSNYRKTMMMASILLFGALALPFAGL-TGQNYshlTALAVL 177 Aspergillus cla...
Q5A6K2        92 CYVKFGFMTVHHTSYVLYLRAVSTAIEGVVAIFLMGIADYSNYRKSFLIFSILVYGFLALPFIGL-TNNDYqtlVLASIL 170 Candida albican...
XP_001382475  85 CYIDFGVGKVHSTSFVLYLKAIYTSLEGLISIFLMGIADYSNYRKILLIGSITLFGIFALPFAAF-TGKNYstlKTISVF 163 Scheffersomyces...
Q75EJ9       113 CYIYVGGRDVQFTAYVLYMRALYTSIEGLIAIVLMGLADFSNYRKWLMTLSIVMYGALATPFVSQ-GSKTYgalILMSVL 191 Eremothecium go...
XP_001804907  99 CVVPFGTGEVDYNSY--------IASEGVVCIFISGVADFTHNRKNLLILGIVLFGTFALPFASM-TSKTYrnlVSGSIL 169 Parastagonospor...
Q0U103       225 AIISNTCFGASFVLLNSFLPLLVRFHPTVrypESSADTSYVSdeeeddsqtptqeriehearwanhlsqreaaldepanv 304 Parastagonospor...
XP_011389368 188 YMVGLITYQLCLSYWTAAFPGLARDLPHM---REARQRLVQArepttvhvetvdd------------------------- 239 Ustilago maydis...
Q0TYS2       160 YIVGLISYQTTVTFWTAAFPGLARNTKEL---RVKAEEFAEG-------------------------------------- 198 Parastagonospor...
Q0CF56       157 YIVGLITYQTTLTFWTAAFPSLARNSAEM---RKKADELTHG-------------------------------------- 195 Aspergillus ter...
Q0CXZ2       160 YIVGLIAYQTTLTFWLAAFPCLARNTATL---QAKADAYNAG-------------------------------------- 198 Aspergillus ter...
EAW12453     178 YCLLTTVGGVYMVAEGSYIPIFMRSTGWFr-------------------------------------------------- 207 Aspergillus cla...
Q5A6K2       171 YSLLIIDDSIYQILEGSYIPLFMRADKKN--------------------------------------------------- 199 Candida albican...
XP_001382475 164 YALMSVIDSVYQILEGSYIPLFMRAVPKK--------------------------------------------------- 192 Scheffersomyces...
Q75EJ9       192 YCLMLCCNTIYTITEGSYIPVFM-DMARLaaaRDAASAKLGDg------------------------------------- 233 Eremothecium go...
XP_001804907 170 WVFMTTVQGIYGTLSSSYIPLFMREAGWI---QARTRIGQDG-------------------------------------- 208 Parastagonospor...
Q0U103       305 ttallpsrapltSPRVKPSTAPSQELA-LSTKISSYGIAIGYIAALLVQTMGIIVVIFFQSS------NFGLRLVLFIIG 377 Parastagonospor...
XP_011389368 240 kvampsveqsvpDDHFSADQYSLLETL-SINRISNIAFTVCSVGELVVLAIIQGMLYAIHADrdeqsnTIALSAVVAVSA 318 Ustilago maydis...
Q0TYS2       199 --------------RITRAEYDFTDMM-KRNELSNTAFYVQSVFEIVILAVIVGIMFGLHVNdseannNWGLSVLIAFAT 263 Parastagonospor...
Q0CF56       196 --------------VISREEYDCADTM-MRSQLANIAFYIQSLAEILILAIIVGIMFGVGVNasdarnSWGLSVLIAFAS 260 Aspergillus ter...
Q0CXZ2       199 --------------DISREEYDQADMM-ERSKLANVAFYVQSLAEIVILAIIVGVMFAVNVNasqdnnNWGLSVLIAFAT 263 Aspergillus ter...
EAW12453     208 ------------DSVVAGQTGERSVWS-KGVSVSVLALVSSNVGGLTALIIGVILVYGRGSYvq--vgYFNYLLAITIGG 272 Aspergillus cla...
Q5A6K2       200 ------------------------PMQ-RGSVVAVLGLFLGNLGGITALVIGIIISYLSGTPes--kgYHNFLLAITIAG 252 Candida albican...
XP_001382475 193 -------------QDEVEEARNTRVLQ-RGSVVSVMGLFLGNCGGLTALLIGIIISYGRGGPme--dgYHNFLLAITIAG 256 Scheffersomyces...
Q75EJ9       234 ------------VEERTAGEPVNPMLR-RGAKVSVLGLIMGNLGSIVAGLVGIIITYSRGKPqa--egYSAFLLTITIAG 298 Eremothecium go...
XP_001804907 209 ------------RLVVTEEERATKELFnRGTMVSVLGLLSGNVGSILGQGIELL-------------------------- 250 Parastagonospor...
Q0U103       378 LWWFIFTIPTARWLRPRP--GPPLHlapqtsnfrTGLAYFSYSWKALARTATHARLLKDVLLFLTAWFLLSDSIAT-VSG 454 Parastagonospor...
XP_011389368 319 AVWLLCAIPWFVMEKHRP--GQPLP---------PGTNYFTAAVKQAVLAAKHLRRLRQTLIYLVFYFLFSDALNT-TVT 386 Ustilago maydis...
Q0TYS2       264 GVWILCAIPWFIFEKRRP--GQD-----------PGGNIIIAGFKQLGYAMSQIWQLRQSLAYLVGYFLLGDSLNT-TVT 329 Parastagonospor...
Q0CF56       261 GVWLIVSLPWFFLEKRRPgqDPGSR------------NIIMAGLSQLYFTMRQVWKLKQSLLYL-------------VVT 315 Aspergillus ter...
Q0CXZ2       264 GVWLLVSLPWFILEKRRP--GQDQK----------GKNIIAAGISQLYYALRQVWKLKQSLLYLIGYFLLGDSLNT---- 327 Aspergillus ter...
EAW12453     273 CITILFAFLGQYLLPSVR--GKEIE---------RKQNLLLLPVRNWIHVVRCAPRYSEAFKLCIGWVLWNTGYSNhLQL 341 Aspergillus cla...
Q5A6K2       253 CLTIGLSLFSALYIPNVQ--GKQRI-----------DNFLVLPFKRFFNLLKDIQKYPMAFLYCISWVIWNVSFNN-FMS 318 Candida albican...
XP_001382475 257 CVTVVFSIISAFYIPSVK--GKPKP---------EGEILLFLTARRFVTLLKNIQKYPNAFLYCVSWVIWNVSFSN-FMS 324 Scheffersomyces...
Q75EJ9       299 CATIVLGSVASLGIPAIH--GSRFPfdp---qenKLITICKFPFRRFMYILRDLTHYREAFKYVVAWVLWNIAYSN-FMQ 372 Eremothecium go...
XP_001804907 251 ---------------------------------------------------KSIPKYPEAFKLCVGWVLWNTGYSN-FNS 278 Parastagonospor...
Q0U103       455 TAVLFAKTT-LGMSYAM--LALINVIATLSGVLGAFTWSRLSSFCALS---------PVQTILCCIFLFELIPLYGLLGY 522 Parastagonospor...
XP_011389368 387 VISTIQNQV-VSFSTTK--LNLLLIVGIAAQAVGIYAFWLIQRHWHLS---------TLYMFCWIVLFTIILQLWGFIGI 454 Ustilago maydis...
Q0TYS2       330 VIGTLQNEI-VAYNSLQ--LTYLLIVGIAAQAVGIGAFWRIQKHYGLS---------TKTMFMVVAVCIVLLDGWGMIGI 397 Parastagonospor...
Q0CF56       316 VISTLQNSL-VAYNTLQ--LTYLLIVGIAAQTVGIYLFWSVQRRYKLD---------TKTMFNAIAVSITLLDGWGMIGI 383 Aspergillus ter...
Q0CXZ2       328 ---------------------------TAAGIYG---FWFVQKRFNLD---------TKTMFNAIAVGIVLLDGWGMIGI 368 Aspergillus ter...
EAW12453     342 ISALFLQVTgFTRNSGV--YSVWSFTNVIFACMGSLIFMYLYPRLQVP---------VKSWAYGFFLVNILCVLWGCIGI 410 Aspergillus cla...
Q5A6K2       319 MFLLLFRST-LGLGNSDaeYTVYTFMSYICSSWGSLVWMFLYQKWNSN---------IKYWGYSFLSVSLLANFWGCLGI 388 Candida albican...
XP_001382475 325 VFVLLFRST-LGIGNSDseYTVYTFMSYITASLGSIAWMLLYPQCGIK---------IKTWGYGFLIFSAFTNFWGCLGI 394 Scheffersomyces...
Q75EJ9       373 LFQLSFRAT-LGSTADKe-YFVWQLMTSVIACVGSLTWMAVFRHFSARrtlraqtqlLKTCLYAMMAAGVVVNFWGSLGA 450 Eremothecium go...
XP_001804907 279 VIGLLFREV-SGLGTGDrlYTVYTFMAVTTASIGSLTWMFVFPRTNIK---------IKTWAYCFLAINIFCIFWGCLGI 348 Parastagonospor...
Q0U103       523 LpavqrLGYLGLQQQWEMYPLGAVYGFVLGGLSSYCRSLYGELIPRGYEAQFYALYAITDKGSSVFGPAIVGAITDRW-- 600 Parastagonospor...
XP_011389368 455 F-----TQQFGFHHEWEVYMYQAYYGLAVCPWYAVSQTMIAEVTPKGSEFLFFSLFSIVGKTSAFIGPFVTQAIADET-- 527 Ustilago maydis...
Q0TYS2       398 W-----SQNFGFHKRWEVWVYQAFYGLLVCPWYSYSQTMISEVTPRGKEFLFFSLFSIVGKTSAFIGPLVSSAIIDDT-- 470 Parastagonospor...
Q0CF56       384 W-----TDKFGFHHVWEVWVYQAFYGLFICPWYSYSQIMISEVTPRGYEYLFFSLFSIVGKTSSFIGPLVSSAIIDATpt 458 Aspergillus ter...
Q0CXZ2       369 W-----TQKFGFHNAWEFWLYQVFYGLFVCPWYSYSQIMISEVAPRGHDFLFFSLFSIIGKTSSFIGPLISSAIIDATps 443 Aspergillus ter...
EAW12453     411 Sn----EVTIGYKHQAEFWVEQVLFMSTSSALRAYNRALYSSLIPKHSEAQFFGLEITLDLATGWINPLVMGVIQNRT-- 484 Aspergillus cla...
Q5A6K2       389 Hk----LTPLGYQNRWEFWVFEVFYSATSSAMRSLNRCVYSSLLPEGNEAQYFGLEVTLGIASGWIGGLVNAVIQDRT-- 462 Candida albican...
XP_001382475 395 Rk----SISIGFKNRWEFWLFEVFYSGSSSAMRSLNRTVYSSLLPEGDEAQYFGLEIMLGVATGWIGSLVNAAIQDRT-- 468 Scheffersomyces...
Q75EJ9       451 Ss----RVPIGFKHRWEFWFFQVIYVSTSSAIRSLNRVAYSAMLPAGRENQYFGLEIMLGLATGWSQSLLVSVIQDRT-- 524 Eremothecium go...
XP_001804907 349 Gk----NVKIGYKYVPEFWIEQTLFCMTSSALRSANRVMYASMLPRGREAHFFGLELTLDLATGWVNPLVQSVIQDKT-- 422 Parastagonospor...
Q0U103       601 GEIRPAFWFLAVLVGLPFPIM-LFVNVERGREEGA 634 Parastagonospora nodorum SN15
XP_011389368 528 GNASTPFYFLLALSLASCILL-WPLDIKKSKVEQA 561 Ustilago maydis 521
Q0TYS2       471 GNNSSPFYFLFALSLASCAWLwWFVDVEKSRIEQA 505 Parastagonospora nodorum SN15
Q0CF56       459 GNSSSPFYFLFALSILGFGILvVGVDLKKSRQEQD 493 Aspergillus terreus NIH2624
Q0CXZ2       444 RNSSTPFYFLFVLSIVSFGVLaIWLDLDKSRREQA 478 Aspergillus terreus NIH2624
EAW12453     485 HNLRFPMIPNLLLMVVGLGLY-WLVDVPKGIEQAK 518 Aspergillus clavatus NRRL 1
Q5A6K2       463 NDDRFPFLPNMFLVVVSLIVY-YYVDLQKGKNDVN 496 Candida albicans SC5314
XP_001382475 469 NNDRFPFLPNCILVLISLVLY-SLTDTEQGMRDAK 502 Scheffersomyces stipitis CBS 6054
Q75EJ9       525 GNARFPYIPNTLLLIVSLGFY-YWSDLSHGMLAAG 558 Eremothecium gossypii
XP_001804907 423 HNLRYPMLPNFFLLVAALGFY-IWCDLEKGVKDSL 456 Parastagonospora nodorum SN15
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap