2VPV


Conserved Protein Domain Family
CENP-C_C

?
pfam11699: CENP-C_C 
Click on image for an interactive view with Cn3D
Mif2/CENP-C like
CENP-C_C is a C-terminal family of fungal and eukaryote proteins necessary for centromere formation. CENP-C is the inner-kinetochore centromere (CEN) binding protein. In the budding-yeast, Mif2, the yeast homolog, binds in the CDEIII region of the centromere, and has been shown to recruit a substantial subset of all inner and outer kinetochore proteins. Mif2 adopts a cupin fold and is extremely similar both in polypeptide chain conformation and in dimer geometry to the dimerization domain of a bacterial transcription factor. The Mif2 dimer appears to be part of an enhanceosome-like structure that nucleates kinetochore assembly in budding yeast. This C-terminal domain is the region via which CENP-C localizes to centromeres throughout the cell cycle 2,3].
Statistics
?
PSSM-Id: 403028
View PSSM: pfam11699
Aligned: 10 rows
Threshold Bit Score: 121.276
Threshold Setting Gi: 197304994
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2VPV_B        75 FALEIMFDKhKeYFASGILKLPAiSGQKKLSNSFRTYITFHVIQGIVEVTVCKNKFLSVKGSTFQIPAFNEYAIANRG-N 153  baker's yeast
Q2GUT9       590 FRYAKVFSE-G-FIGAGVVDLPP-GAIKRLKNSRKVFMIFFVHAGRVLVTVQETSFRISKGGIFIVPRYNEYTINNDY-D 665  Chaetomium glo...
EDN96709     562 FKFAKTLTL-P-FFGSGMVDLEP-GAVKKPKNSRKMQMVFFVFYGRVEVSVNGTSFRIGKGGMWQVPRASPTITIN---- 634  Sclerotinia sc...
XP_001545013 473 FRFAKILNN-V-FLGSGFVDMPP-GAVKRPKNSKKMHMVFFVYHGRIRVNVSDLQFSAGKGCVFQVPRGNNYSFANDY-D 548  Histoplasma ca...
Q2UBG4       438 FRFAKLLSS-P-FLGSGIVELPS-GGVKKPKNSKKMHMVFYVCRGRVQVDISGVQFSAGKGCVFQVPRGNYYSFANTH-G 513  Aspergillus or...
Q6CVA1       464 FTLSILFDKhKeRFASGMLKLPL-DGEKTPSDSHNAFINFFVVKGVVEISVGDNKFVCTTGSSFQVPAFNTYGFLNKG-M 541  Kluyveromyces ...
BAA24110     751 IKVYKSLNT-S-DFAAGKLILKP-LKEKGHQFVHMDTIAFYVIRGQIITTLHKTSYYLTSGDYFYVPAGNGYNIRNLL-N 826  chicken
Q03188       856 LKVYKTLDT-P-FFSTGKLILGP-QEEKGKQHVGQDILVFYVNFGDLLCTLHETPYILSTGDSFYVPSGNYYNIKNLR-N 931  human
Q5KCD0       549 FKYQKVFGE-GhFMAAGIVYIPV-GQIKNTKPSKDNTYVFYVIQGAVQVTIYRTSFVMAPGSQFLVPRGNDYCIENISpD 626  Cryptococcus n...
XP_011386202 609 FRFEKFFNS-GgVMATGILHLPP-GASKPTKSAKDNSFVFCVLQGALRASVHRKSFIIGPKGVFQVPAGNTYSLENIC-Q 685  Ustilago maydi...
2VPV_B       154 DEAKMFFVQ 162  baker's yeast
Q2GUT9       666 QSARIFFAQ 674  Chaetomium globosum CBS 148.51
EDN96709     635 --PREYFLH 641  Sclerotinia sclerotiorum 1980 UF-70
XP_001545013 549 KPAALFFTQ 557  Histoplasma capsulatum NAm1
Q2UBG4       514 KDARLFFTQ 522  Aspergillus oryzae
Q6CVA1       542 TEAQLFFVQ 550  Kluyveromyces lactis
BAA24110     827 EESVLHFTQ 835  chicken
Q03188       932 EESVLLFTQ 940  human
Q5KCD0       627 KEAQLFFAQ 635  Cryptococcus neoformans
XP_011386202 686 REVHLFFAQ 694  Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap