Conserved Protein Domain Family
DUF3289

?
pfam11692: DUF3289 
Protein of unknown function (DUF3289)
This family of proteins with unknown function appears to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 403021
View PSSM: pfam11692
Aligned: 10 rows
Threshold Bit Score: 366.658
Threshold Setting Gi: 317109083
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAX62027            4 ARFPQTIFSTQRPFDDYGTDDMRCGDITESRLKDEFTLSTISNVVDPY---TLTRLTAFNNPQSRFAGVYg-dKRAGKVS 79  Erwinia bi...
jgi:Fraau_1954      4 LQLPCTIFQTQHRMNDYGARDMRCGDLTAEQLKRQFHLEKISIQVDPY---TLKKLRSSSPLQYALDDFY---RNEETIT 77  Frateuria ...
jgi:Fraau_2594      4 LTLPCTIFKTRHRMNDYTARDMRCGDLTAYQLQHQYQMGRVSTKVDPY---RLKKIRPFTPSQYQLSHII---KSEENIT 77  Frateuria ...
WP_014403010        4 MQTPCIIFQTRHRMDDYGARDMRYGDLTADQLQHQYHLEQVSATIDPY---RLKKRLPFTPSQYQFGTYY---KSESDIT 77  Frateuria ...
Q9PGZ1             30 LDFPFVAFRSELPMNDYSAPDMKCGDLTKEQLIHDFGLSFVSFHVNPF------------NNEEGFIK-----GKSKIIS 92  Xylella fa...
Ansesd:TEQUI_0897   2 yienLEIFKSVNLFNDYSSPDMKCGDLNLETLLSKFKIINPSQLLNPY---TGQLFQLDPNPITGFKY-----KPRKKLN 73  Taylorella...
WP_013027763        4 MVFPVTLYQTKHQFNDHSSDDMQCGDLTEKQLRSDLGLDDVSDVVDPW---TGEEVSIFSSF-----------RKSQPKS 69  Pantoea
WP_012134323        9 MSLPYEIFSTSRRFENYYIDDMQCGDLSDWDF-EMLGVMDISARVDPFrclQFDMMTTFNIHPMNFDHQQ---LQGTPIS 84  Citrobacte...
WP_012134326        9 MSLPREIFSTSHRFEDYHIDDMQYGDLDDWDF-YSLGLKDISARVDPFrclQFDMMTTFNSQALDFGHQQ---PQGRPIS 84  Citrobacte...
WP_002214774       18 LQFPLCIFKTRNRMDDYGAADMKNGDLTEAELKGKFNLRGVSVTLDPY---TGEK------TPTSFAMDHfnkKPKEKVN 88  Yersinia p...
CAX62027           80 VEECARLLFDELQVTSLPFSIY---GPYRNLINQMFSHMQTANGAPFRDLQLDRGYREQILNDDSEK-S-----TRLGIQ 150 Erwinia bi...
jgi:Fraau_1954     78 AEQCARLLFDEFRRESHAFAFY---GPYRHLIIGMINHMQYGNGAPFKRPLLDTATREQILHNTTSN-S-----SLLNIQ 148 Frateuria ...
jgi:Fraau_2594     78 LQQCAKIMFDEFRSAAQPFSFY---GPYRHLITKMINHMQYNNGAPFSHMLLDMALERKIRSDTSVN-S-----IINMIR 148 Frateuria ...
WP_014403010       78 LEQCARILFDEFRSESRLFSFY---GPYRHLIIDMINHMQHANGAPFRHILLDMALKNKIINSTSTK-S-----NIKIIN 148 Frateuria ...
Q9PGZ1             93 DEEVVIILFNEFRFWARVLSF----GRYSSLMQSLISNFQDNKGTPFSDPLLDKAFKELILNERSEN-G-----SISRIK 162 Xylella fa...
Ansesd:TEQUI_0897  74 TQLITEMLFDEFRHFVGYYSMFglgGPSTRVIYKLIDRFQQNSSAPFNHPDLDRIYKSRIYKDAGVGiSkdgylSITHIE 153 Taylorella...
WP_013027763       70 KTVIAQILFDEFLRVSLPTYYL---GQH-NLFNNLVKHFYHGNGKSYSSPFLDSAYKSLILNEQSSPlS-----SLKIIQ 140 Pantoea
WP_012134323       85 RQYCADILFDEMKVLSTQFA-S---GQYAFLIGELIDHFHYGNGRPWSSERLNHAYAEVIRGAGTND-------VLIKIQ 153 Citrobacte...
WP_012134326       85 RQHCADILFDEMKELSVQFA-K---GLYSPIIGELIDHFHYGNGQLWFGELLNRAYADVIRGAGTND-------VLMKVQ 153 Citrobacte...
WP_002214774       89 KAEVARILFDEFRHLSDTFSFS---GKYQSIMRKMITYMQINNGAPFRDLLLDSALKEQILSDKSND-S-----SLLKIK 159 Yersinia p...
CAX62027          151 QVINDNVNFDKEGFPQKE-IITITDSV-SDKVLPKFDSLVfDKINGLGITVHDVYATHIEIISLDIRGNRWRAKVKYTGQ 228 Erwinia bi...
jgi:Fraau_1954    149 ATLKNNIDWKQAIYHEEK-KWMLTKAV-KDSRLPKFTHLK-HYINGLGISVHDTWSTCITLEDLAVHKNTYYATLHYRIQ 225 Frateuria ...
jgi:Fraau_2594    149 NTLKENMNWRKNIYPAEN-VHAFRTNI-LKATLPKFTSVM-DNFNGMAISVHDTWATHITLTSLEVREDGYLARIHFRVQ 225 Frateuria ...
WP_014403010      149 TTLKSNINWKESTYPMGK-ISDFRDNI-SEGALPKFTSLL-DAINGMALTVHDTWATQITISNLFVHDNFYNAKIHYKIQ 225 Frateuria ...
Q9PGZ1            163 SVFDNCIDWERGVFPSEN-KEYLIETL-KSAIYPEFTRVQ-DTFNGLGLAVHNINSMNIEINSCNIYDDHYCASVHYQGQ 239 Xylella fa...
Ansesd:TEQUI_0897 154 EILNNNSDKSKSQL-----VEMLHELI-AGKKLPKFNSFW-DYFNGTIISIHDIHATRIVIKHLDINKNGYDGVIGFYAQ 226 Taylorella...
WP_013027763      141 SMLDKVAIDVKNGLSDAD-KDSITKAI-GNSILPKFNRWA-DSFNGLGMSIHDIYATKIQLTKIDITESGYVAKVTFTGQ 217 Pantoea
WP_012134323      154 KAIDYHLYLNREASLDYNfFTSLNLAI-RHLKLPKFNRFN-DRFNGLGISVHDIYVQQIKLVRFQRYAMSWEGLLSFKGQ 231 Citrobacte...
WP_012134326      154 KAINGRLYSERQVILDYNfFMELKTAIkRDSRLPKFNRFI-DRFNGLGVSVHDIYAQQIKLVRFQRYAMSWEGLLSFKGQ 232 Citrobacte...
WP_002214774      160 NALIENIDWNNGHYPINN-KGMMTEAI-KDTVLPRFNRLN-DRINGLGISVHAIHATHITIRSLQVNGNEFRAIVHYRSQ 236 Yersinia p...
CAX62027          229 DHFGLDVNDISKQRFHQFHFFRIWFVLQRFNRFGFSPFMTNMEATIDIQ 277 Erwinia billingiae Eb661
jgi:Fraau_1954    226 DHFGLDEADISGPILSRLAIFRIWFVLQHYQRFGFKPYITSMDAKLEIS 274 Frateuria aurantia DSM 6220
jgi:Fraau_2594    226 DHFGLDDNDAIQYKSRIFSFIGLWFVLQHYDKLGFKPFVTNMQSIIEIH 274 Frateuria aurantia DSM 6220
WP_014403010      226 DHFGLDEQDILKYQTRNLSIIKTWFFLQRYNLLGFKPFMTNMEATIDIS 274 Frateuria aurantia
Q9PGZ1            240 DHFGLDDGDIIDIRFHYFSIFRIWFVLQRWNRYAFRPFMTNMRANIEIS 288 Xylella fastidiosa
Ansesd:TEQUI_0897 227 DHFGLDDNDVLKIPQNYIQPFGIWFLLQRYEKFAFKPFLFNMQSEIKIQ 275 Taylorella equigenitalis MCE9
WP_013027763      218 DHFGLDKTDIMNMKFHYIRAFRIWFVLQRWEKFAFKPFFTNMKAEFEIS 266 Pantoea
WP_012134323      232 DHFGLGREDIANELYKNFCFFRIWFFLQRHSDYAYRPFLTNLNAHAHIK 280 Citrobacter koseri
WP_012134326      233 DHFGLGKEDITNTLYKNFRFFRIWFFLQRHRDYAYRPFLTNFSAHVCIE 281 Citrobacter koseri
WP_002214774      237 DHFGLDNTDMLDSFYRQFRIFHIWFVLQRWRGLGYKPFLTNMEASIEIT 285 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap