Conserved Protein Domain Family
DUF3277

?
pfam11681: DUF3277 
Protein of unknown function (DUF3277)
This family of proteins represents a putative bacteriophage protein. No function is currently known.
Statistics
?
PSSM-Id: 403015
View PSSM: pfam11681
Aligned: 8 rows
Threshold Bit Score: 205.032
Threshold Setting Gi: 260863122
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Xaut_3640    1 M------NVTASIVGTGGSFSLGYGSDNAEEGISVSMLEDKNTMMVGADGGVMHSLHAGRAGSITVRLLKTSPVNKQLMD 74  Xanthobacter ...
Q7N2P1           1 MatysflDVSASITGVGGSFDLGNGAALSDEGITVTMSESKNTMTTGADGEVMHSLHATKSGTITVNLLKTSPVNAKLNA 80  Photorhabdus ...
Q2NT58           1 MatysfmDVSASMTGPTGVIDLGYGSANAEEGIVVAMTEAKNTMTIGADGEGMHGLHAGKSGTITINLLKTSPFNKKLML 80  Sodalis gloss...
WP_024910418     1 MatysfaDVSATLAGPSGVIDLGYGASNADEGIVVSMSGPQNTMTLGADGEVMHSLHAAKSGTISITLLKTSPANKKLSS 80  Chania multit...
EEX77622         4 hstysftDINATIRCPGYGSYSVQGEGVGD--VNVSKNTERTVHDVAADGSVMASKIAGNNGSVTINAQQTSSLHKFLQG 81  Selenomonas s...
CDA50586         5 LstysfsDVVGSIHCGLMEDYVFTGKGVGS--ITISKSTERTTHDIAADGSVMVSKVPGNNGTVTIEVQQTSPLNKWLNG 82  Dialister sp....
WP_014199388     4 sntysflSVQGTIVGPGGAINIGSTAGVASEGITVEPSEDKNTMTMGADGAVMHSLHAASPGRAVVRLLKTSPVNAMLSL 83  Azospirillum ...
jgi:Fraau_1498   1 MatysflDVAATITGVGGSFRLGSGAGVAEEGISYEMTEDKNNMTVGADGQVLHALHAGKSGHITIRLLKSSPQNAKLQA 80  Frateuria aur...
jgi:Xaut_3640   75 LYRF-QTSTPANHGANTLTVRDTMRGDVVVAQKVAFRKIPDNSYAKAGNILEWVFDCGIIDEKLG 138 Xanthobacter autotrophicus Py2
Q7N2P1          81 MLST-QSLSSAAWGNNVIVIRNKQSNDIAVARSVAFQKQPDLQNNKAGGTVSWVFDCGKIDIMLG 144 Photorhabdus laumondii subsp...
Q2NT58          81 AYNA-QSQSSALWGNNVFVIRNHASGDIATARGGAFQKIPDWQNAKDGNTVAWVFDCIKIDEFLG 144 Sodalis glossinidius str. 'm...
WP_024910418    81 VYGA-QGLSSTLWGNNIITIRNTASGDTIVARNCAFQKRPDHVNAKEGGNVTWVFDCGKVDQMLG 144 Chania multitudinisentens
EEX77622        82 LFNYcWQADTSEWTSISMTIEAPKMGKTYYCTGGSFVKEPDEPLQSQGQRVAWSILFVDIQriql 146 Selenomonas sputigena ATCC 3...
CDA50586        83 WFQKlWNSPTSKWASTTILIRNGHLGNTHVCVGVSPSKEPDTPYQSQGGRVTWQLMCADIvnnpi 147 Dialister sp. CAG:486
WP_014199388    84 MYNF-QKSSAANWGGNTIAFSDVDRGDVITLTSAAFRKQPTVVYNVEGPMNEWEFEGVlniqlgg 147 Azospirillum brasilense
jgi:Fraau_1498  81 MYDA-QSLSSATWGQNVISIRNSAVGDVIACTQVAFRRSPSNTYAKDPNVMEWQFDAGQIDAILG 144 Frateuria aurantia DSM 6220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap