Conserved Protein Domain Family
DUF3262

?
pfam11660: DUF3262 
Protein of unknown function (DUF3262)
This family of proteins with unknown function appears to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 403002
View PSSM: pfam11660
Aligned: 22 rows
Threshold Bit Score: 57.7048
Threshold Setting Gi: 120587675
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014148567     1 MTNQQAAAFTQATGniANPGQLLLGIAMVFAVIYLLWLVWIAQSQYHAWQTRKGDFYDMTSSVLRAIVVVLLVGYFI 77  Methylomicrobium...
jgi:Aave_0509    3 aSADQLAAFQANGG--FPASAVADVVLGFVFAVLLLWGVWAMRAAYAGWAEQRLSQRQFLAVVVRFLALYLVLTFLL 77  Acidovorax citru...
WP_014159653     1 MNAAQTAAFQANGG--FPPSAVSVVVIGAVFAVLLVWGVWAMRTAYVGWAEQRISQRQFLGVVVRFVALYLVLTFFL 75  Pseudoxanthomona...
WP_012205981     1 MNGAQVSAFQANSG--IAPSAMATVLVGIVFAVLLVWGVWAIRTAYVGWAENRLNQRQFLGVCIRFVAMYLVMTFFL 75  Proteobacteria
WP_012639388     1 MTGDQVTAFQANSG--FGPSDVSVVLVGGVFVVLLLWGVWALRTAYVGWAENSISQRQFLGVAVRFVAMYVVLTFFL 75  Gammaproteobacteria
WP_013786568     3 vSASQEAAFTGATLg-VPMSSFNLTILLIFYSVLYIWAVWVIYTQWKAWSRRKIDFYDFLIRSVRPIFLTLVLGFLL 78  Alteromonas naph...
Q3JDD6           1 MTAAQQTAFQAGSG--ITPATMLTSIASMVLVLAFVWVIWVALGVFRAWQEGQATVFDLTWSTLRASIVLMVLGFYL 75  Nitrosococcus oc...
WP_014148602   216 plinPSAAFTNSAGg-VSYQELKIAIQSIIAILLFLWLAFVSWSQFKMWGANSISIMAMKSTIIRATALMMLLLFIF 291 Methylomicrobium...
jgi:Metme_2038 205 pqpSPSTAFASGAGg-ISFQNIKTAIQSIIAILLFLWTAFVTWGQFKLWGDNGISMMGMQTNIFRASVVMLLLMFIF 280 Methylomonas met...
WP_025282645     1 MNADQQSAFEAAAG--VGVNTLVLTIAGISAVLYLLWLAWTALTQYRAWNDGRATFFDMTWLVIRATILVMLLGFFI 75  Ectothiorhodospi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap