Conserved Protein Domain Family
CBP_BcsG

?
pfam11658: CBP_BcsG 
Cellulose biosynthesis protein BcsG
CBP_BcsG is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).
Statistics
?
PSSM-Id: 403000
View PSSM: pfam11658
Aligned: 21 rows
Threshold Bit Score: 668.212
Threshold Setting Gi: 81606405
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR44189       21 WNFYFLLKFVLLWYGYLKFDAFSNLLFLAFLLF--PLPKKFWHKLRNWIAIPIGVMLFYHDTWLPSFSTVLEQGGQLKNF 98  Proteus mirabi...
jgi:Galf_0489 198 WGYYFAAKLALFGLGTITFHPMENLLFAALLLL--PVSSRLLYRLRAIFATLLALALLYYDSWLPDIRRLITQASQLSDF 275 Gallionella ca...
Q7NUM4         22 WSLYFILKLLLAWRGALSAHPAPDLAFALVLLL--PLRRRWLRLARDALAWPAAAILLYYDSWLPPPAALWRELSELKGF 99  Chromobacteriu...
jgi:Rmet_2257   4 WNLYFLAKIYLFHTGQMQPIWLLNLVFALLLVI--PLESRILRVLRQIIAIGAGAALAWRESTLPPFTRLLTEFSNIRAF 81  Cupriavidus me...
Q63JZ0          4 WNLYFVLKLYLFAAGHLKPLWIANLGFALALALsaPARRRSVQLLRHALALALAVPLMYREADVPPLARLVETLGGLRAF 83  Burkholderia p...
WP_012347100    4 WSLYFLVKLGLHVAGLIQLDVPLNLLFAVALAW--PWAHPGWRRAWRFLAWPVAVALLYHDSFWPPATRILSQWQAISGF 81  Leptothrix cho...
WP_011911521   23 WNLYFLLKFLLLGLGLLNFQALPNLVFAAFLVV--PLPGAPWRIVRQLIAIPVGIALLYHDTWLPPFDRLLAQPG-VLDF 99  Pseudomonas st...
Q5DZ39         16 WNIYFIIKIGLFLQGIIDFHPIENFALVAFLLI--PIRHKILNVIRQFLAVPFGLWLMHYDSFLPPLDRLWSQMGQLLQF 93  Aliivibrio fis...
BAJ00105       19 WNVYFIIKIALYLKGSIDFHPVENFAFLALLLF--PLASKRLAIARTLIAVPIGLWLMHFDSYLPPLNRLWSQMGQLMQF 96  Shewanella vio...
Q6LRF3         18 WNVYFIIKIALFLKGDISFHAIENFAFISFLLL--PISLKWLSITRTFISIPVGLWLLHFDSYLPPLDRLWSQIEQLMQF 95  Photobacterium...
CAR44189       99 SFSYLIELAVNFINLKMIGVAFILLVGYLFIEQWVRVSVFIIAGVVWLNISGfthfsgamasavsansftqqtntsidqp 178 Proteus mirabi...
jgi:Galf_0489 276 SWAYVVELSGRFFSWQTTGLLLALSIAYWIVSRRIRVGVFIVLGMLMLWGWQ---------------------------- 327 Gallionella ca...
Q7NUM4        100 SLSYLMELAGRILTPTLLIGFTVVLAGYLLLSRFLRLGTLVMATLLALSAHElwqqrap--------------------- 158 Chromobacteriu...
jgi:Rmet_2257  82 TPGYLVELFQRFVPVQMVVAVVLVVLVYLLINRWIRTTTLVLLALIAMPIWYgtgitlpga------------------- 142 Cupriavidus me...
Q63JZ0         84 SAGYWMELVPRFVPPMLALAALGVVIGYLIVNRWLRVATFVLLALIALPVWQagsaalarl------------------- 144 Burkholderia p...
WP_012347100   82 SFAYLVELVGRVINVQLLVAVAMGAALWWVLKQRLRLATWVFVGLVAVAALPsqhggvtdla------------------ 143 Leptothrix cho...
WP_011911521  100 SPAYLVELAGRFVDWTVLGLCALLVIGYSYMANWIRLSTICLGGLIWLNLgsipllasp--------------------- 158 Pseudomonas st...
Q5DZ39         94 NLSYLIELASRFVSLETLLGLFVLVFAYYFLNQIFRISVFVVITLIAISLPSdlfssqpntvan---------------- 157 Aliivibrio fis...
BAJ00105       97 ETSYLIELLGRFVSPSALLAIFTLCIGYFILSKYLRISVLVVGLLVYISLPEpatviapqpgaa---------------- 160 Shewanella vio...
Q6LRF3         96 ELSYLIELAGRFISLTTLLTIFTLSAAYYLLNKYIRVTVLVLISLIYISVPQsiittpninntp---------------- 159 Photobacterium...
CAR44189      179 qpqnteilstaqtrapnnnvLSSPYPPQKQPANNK-VLDEWLAQFYRYENKRSTPAPAQlSSYAQP-FDILIINICSLST 256 Proteus mirabi...
jgi:Galf_0489 328 --------------------NAARLSADKAILNVDlDMNKVLQDFFLKEAQRSILFVTP-QTDAVP-FDVIFIHVCSLSW 385 Gallionella ca...
Q7NUM4        159 -------------aasassaFGGAPSAQ--------TPDQRLEGFFRSEQRRQVGFQGPlAD---PgFDVLLLHVCSLSW 214 Chromobacteriu...
jgi:Rmet_2257 143 ------------kaqqataqSAGSARADINATN---NYDAILAAFRQQETQRTATFSPLtATPDAQ-FDIIVLHICSLSW 206 Cupriavidus me...
Q63JZ0        145 -----------daaaaavpgPAGTGRAVQPQ-----DHNAALAAFRSQESQRQVTFGRPsADPATQ-FDVIVLHVCSLSW 207 Burkholderia p...
WP_012347100  144 ----------qaatgadgtaDRAADRATAPLLDAG-QLDQALQAFYDTERGKILRLP---KDGNVPgFDLLILNICSLSW 209 Leptothrix cho...
WP_011911521  159 ------------pradaapvVASAQGNDAPALQDNvALDTWLENFFRTEATRQTQFPLRsEQTAA--FDVLFINVCSLAW 224 Pseudomonas st...
Q5DZ39        158 --------vsqqpesaetaqISDHQVDETGPVNDA-VLNNAKELFFRNEAQRRVSFPTTsPSTD---FDLLFLSICSVAW 225 Aliivibrio fis...
BAJ00105      161 ---------vantanvtsvsETVPKAREVTVINDD-VLNNLKNDFFTNELKRSVSFNPT-AKDDVP-FDLLFLSICSVAW 228 Shewanella vio...
Q6LRF3        160 --------sllaqqqttdqnEKEKHPLQISEVNDD-VLNDFRNNFFADEAKRVTNFNNN-TQSDAP-FDLLFLSICSVAW 228 Photobacterium...
CAR44189      257 ADAAAVGLQQHPIWGNFDVLFNRFNSVASYSGPASLRLLRASCGQTQHADLYD-PVDMQCLLMDNLAALGFEKKLVLDHN 335 Proteus mirabi...
jgi:Galf_0489 386 DDVRAVGLEDHPLWQRFDILMKKFNSAASYSGPAAIHFMRAKCGQTEHGVMYT-TVADKCYLMNSLQLSGFEPNLVLNHD 464 Gallionella ca...
Q7NUM4        215 DDLRAVGFDNPPLLARFDIVFDRFNSAASYSGPAALRVLRASCGQPRHSALYE-PAPEQCFLFENLAKAGFKTELSLNHD 293 Chromobacteriu...
jgi:Rmet_2257 207 DDLDAAKSLNHPLLSRFDYLFKNFSSAASYSGPAAIRLLRASCGQQPHKDLYD-PAPAECHLFADLAQAGFTPRILMNHD 285 Cupriavidus me...
Q63JZ0        208 DDLDVARLRNHPLLGHFDYLFTNFSTAASYSGPAAIRVLRASCGQEAHADLYK-PAPAQCHLFGQLAAAGFAPQTLLNHD 286 Burkholderia p...
WP_012347100  210 DDLAFAGLRNAPFMRRLDVVFDRFNSAASYSGPAVMRLLHGTCGQPAQHELYG-GAVADCYLFRNLEQAGYRPALLLNHD 288 Leptothrix cho...
WP_011911521  225 DDLDAVELRDNALLKRMDVIFDRFNSATSYSGPAAIRLLRASCGQPRHQALYE-PAPEQCLLFQNLANLGFHAETLMNHN 303 Pseudomonas st...
Q5DZ39        226 DDIEIAGLESHPLFKEFDVMFDNFSAATSYSGPAVIRLLRASCGQESHPELFKaPASKQCFLFDNLAKLGFQENLLLNHD 305 Aliivibrio fis...
BAJ00105      229 DDIEISGLSDHPIFKEFDIMFDRFNAATSYSGPALVRLLRANCGQETHGELFDaPASNKCYLFENLAKLGFKENLLMNHD 308 Shewanella vio...
Q6LRF3        229 DDIKLVGLQNHPIFDDFDIMFDNFNSATSYSGPAVIRLLRANCGQEEHSQLFDdAASNQCYLFENLADLGFQENLLMNHD 308 Photobacterium...
CAR44189      336 GEFGHYLQEIREL-GNLNVPLQDQSGLSHQITAFDGSKIYNDKETLERWLKAREKSDEK-RTVTFVNLVSLHDGNRFVGE 413 Proteus mirabi...
jgi:Galf_0489 465 GKFDDFLGQLKKH-GRLNAPPMSLEGLEVAQHAFDRSPVYDDFSVLDRWLQTRQTSASS-RVAMYYNTVSMHDGNHVSGA 542 Gallionella ca...
Q7NUM4        294 GSFDSFLQQIRRN-GRMNLPLTPQDGVAVGQRGFDSSPIYSDYAMLNRWLQLRLQEPDP-HVAVYYNTISLHDGNRIPEA 371 Chromobacteriu...
jgi:Rmet_2257 286 GRFDNFRTYVETEiGIQGVKMESTEGVPVAMRAFDDSPILDDFNTFDHWYKQHLAQDKG-PVALYYNTVTLHDGNRLPDK 364 Cupriavidus me...
Q63JZ0        287 GHFDNFLQLIRENiGVPNAPMIPNADAPVAMHAFDGSAIKDDYATLANWYAKRGASPG--PVALYYNTISLHDGNQLTGG 364 Burkholderia p...
WP_012347100  289 GRYDNFSTELRRD-SGLGLVPEQRFDAAVAMSSFDGSPIRDDGETLTRWWSDRTAAASGvPLAMLYNSITLHDGNRVPGI 367 Leptothrix cho...
WP_011911521  304 GKFDGFAGEIEAQ--GMPQPVLASQKFARALAGFDGSPIARDFDVLNGWWQRRQALPEP-QVSLFYNSISLHDGNRIVGA 380 Pseudomonas st...
Q5DZ39        306 GKFDDFLGLLKED-GDLKAPLMSQAGLTQYQSAFDGSPIYRDKDVLNRWLDKREKSQDG-PTVALYNTISLHDGNRIIKA 383 Aliivibrio fis...
BAJ00105      309 GVFDNFLELLQQK-GKLNAALMPLDGFKPYEKAFDGDDIYRDKDVLDHWWQQRIRNDNN-QVVALYNTISLHDGNRVIGG 386 Shewanella vio...
Q6LRF3        309 GVFDSFLSLIKKD-GKIETNLMPQEGLTPYQKGFDGASIFRDKDVLDRWWQERIENDSG-QVVALYNTISLHDGNRIINN 386 Photobacterium...
CAR44189      414 NTT----ADYGKRASALLDNLNAFINTLDKRGRKVMVVIVPEHGAALQGDITQMSGLRDIPSQSITTVPVGIRFTGLKnq 489 Proteus mirabi...
jgi:Galf_0489 543 DASsdtlVNYKNRLNKFLDETDRFLQKLETSGRRAVVVMVPEHGAAIRGDKRQIAGLREIPTPSISLVPVGIKMVGGG-- 620 Gallionella ca...
Q7NUM4        372 PALdt-dASYKYRAGRLLRDIGQFIDLLEQDHRKMILLLVPEHGAALRGDKQQFSGLREIPSPLITTVPAAIKVIGSQ-- 448 Chromobacteriu...
jgi:Rmet_2257 365 -RLts-iESYPLRLKTLLDDVDRIIDTISKSGRKAVVIFVPEHGAALRGDKNQISGLREIPTPNIIHVPVGVKLVGLPt- 441 Cupriavidus me...
Q63JZ0        365 -RMss-lDSYPLRARKLLDDFDRFADLIAASGRRAVIVFVPEHGAALRGDAKQVAGLREIPTPRIVHGPVGVRLVGFK-- 440 Burkholderia p...
WP_012347100  368 QSLss-lETYAPRARKLMADLERFAALVEASGRPTVLVLVPEHGGAVRGDAQQIAGLRELPTPAITHVPAGVMLIGMGer 446 Leptothrix cho...
WP_011911521  381 DGNaq-sAAYRPRAQRLLDDLNRFIDELERSGRPVALLLVPEHGAALHGDRMQIAGMREIPRPSITQVPVGLKLIGMD-- 457 Pseudomonas st...
Q5DZ39        384 SGKvg-lVSYKLRLKNLLDDLYDFFQELKASNRNIVVMLVPEHGAGMRGDKMQIAGMREIPSATIVHTPVGMKIFGQG-- 460 Aliivibrio fis...
BAJ00105      387 ESPtn-lISYKRRLKNLLDDLYGFFQELKASKRNIVVMLVPEHGAGMRGDRMQIPGMREIPAASIVHTHVGLKVFGDN-- 463 Shewanella vio...
Q6LRF3        387 NASts-lISYKRRLNNLLDDLYSFFNELKASERNIVVMLVPEHGAGMRGDKMQISGMREIPAPSITHVPVGLKVFGKN-- 463 Photobacterium...
CAR44189      490 rLPH--TPMMIDKPSSYLALSDFILRNVNGDIFNQPTIDWNALTRELPQTATVSENQNTIVVDYQGKSYIKLNEGEW 564 Proteus mirabilis...
jgi:Galf_0489 621 -VQRegDALTIDQPTSYLAISHIIERTLEQSPFANGRFRSADYVQNYPHTRFVSQNETVTVAESQGQYYLSRGASQW 696 Gallionella capsi...
Q7NUM4        449 ---GrpAQYRVTQQASYTAIATILSRMLARSPFGA-DYQPESYAQDLPATPFVSENANFTVMQSGSRYLMQSSGGNW 521 Chromobacterium v...
jgi:Rmet_2257 442 --TAtpQPVTIDAPTSFFGLSQLVFNLVADSPFRQGAPDLAHYVEDLPQTQMVGENEATLTMKRTNGYVIHTPDGVW 516 Cupriavidus metal...
Q63JZ0        441 --GDhgATTVIDAPASFLALAQLLANLVSSSPFK-PGVTLSQYAADLPQTRMIGENEGTVTMTTPTGYAVKTPDGVW 514 Burkholderia pseu...
WP_012347100  447 -rADgqEPVHVEQTSSYLSLFTVVAALMHGGPEVATPERLTEVAQALPPVEWVAENDKTIVLRRGPHTYVRDFEGRW 522 Leptothrix cholodnii
WP_011911521  458 -APHgtQPVHIQQPTSFLALSELVSRLYAARQQGS-TPNLGALVADLPQTELVSETAGAQVIERAGKPYVRLS--GQ 530 Pseudomonas stutzeri
Q5DZ39        461 -MTRlgSTAHISAPSSYLAVSTLVSRIIEEDIYATKTFNTAELVKDLPTTKMVAQNSGTTVMEYNKKPYVSLDGTTW 536 Aliivibrio fische...
BAJ00105      464 -MKRvgDTVHITDPSSYLAVSQLVSNILDSNIYKTNTFDPKVLTTNLPKTKMVAQNSGTTVMEVKDKHYISLDGSTW 539 Shewanella violac...
Q6LRF3        464 -IERtgKNVHITAPSSYLAISSLVSNILDQNIYELATFDPEKLVINLPETSVVAENSGTTVMDINNKHYISLDGNTW 539 Photobacterium pr...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap