2OST


Conserved Protein Domain Family
PDDEXK_5

?
pfam11645: PDDEXK_5 
Click on image for an interactive view with Cn3D
PD-(D/E)XK endonuclease
This family of endonucleases includes a group I intron-encoded endonuclease. This family belongs to the PD-(D/E)XK superfamily.
Statistics
?
PSSM-Id: 402991
View PSSM: pfam11645
Aligned: 18 rows
Threshold Bit Score: 130.169
Threshold Setting Gi: 746976055
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OST_D            3 STKLKGDIAQQAAIMRALKMGWGVLKPLG-DRLSYDLVFDVEGILLKVQVKSSWKSEKtgNYVVDNRRTRTNRRNIVRSP 81  Synechocysti...
WP_066144411      8 NTKDRGDETEAKVIHEMISHGYSVSIPFG-DNDKYDLIVDDDGQLYRIQCKTAWQNKEe-TIRFNTHSQTTKKGNYHENQ 85  Haladaptatus...
CQH61498          2 QSHRKGDLTEAIAIAEVKRRGIPVSVPFG-DNERYDLILESEAGLYRVQVKTGTFDGE--TVRFKGYSIHTNSEGNVHNA 78  Halobacteriu...
WP_017749489      2 DTKLKGDIAEQAAILHALKRGWGVLKPVG-DRLPYDLAFDVQGNLIKIQVKNAWFDEPsgNYVVDNRRTKTNRRLMLRDV 80  Scytonema ho...
WP_045054052      2 DTKLRGDIAEQAAVLHALKRGWGVLKPVG-DRLAYDLVFDVYEVLIKIQVKYAWWDEPssNYIVDNRRTKTNRRLMIREG 80  Aliterella a...
ASGPB:GKIL_1265   2 DTKLRGDVAEQAAILQALNHELGVLRPIG-DRLPYDLVFDVSGTLFKIQVKCAWLDLSsgNYVVDNRRTKTNRRVMLREA 80  Gloeobacter ...
KIF32702          4 HTKNKGDIAATKAIADLTLKGYLILTPVVcEHLPFDFVAYKDDKFYRIQAKYSg------DNRVVNKTIWVDKNGIHRRK 77  Hassallia by...
EON24873         37 HTKDKGDLGTAKAHADLVGLGFTVLFPAT-EHAAFDLVAYRDGTFHRVQVKYR--SARsgTISVQFRSVWADRNGTHMKP 113 Nocardioides...
WP_036396434      5 HTKDKGDLGVAKAHADLVAKGFDVLFPAT-EHAPFDLVAHSDGIFHRIQVKYR--SAPsgVVSVNLRSTWSDRHGVHSTP 81  Mycolicibact...
WP_019512141      5 HTKDKGDLGVAKAFSDLVAKGYTMLFPAT-EHAAFDLVAYRAGVFVRVQVKYR--CARagVIKLNLRSTWADRHGVHSVP 81  Mycobacteria...
2OST_D           82 YRgNDFDFAVAYVEELELFYV-------------------------------------------FPVDVFIs-yGSEIHL 117 Synechocysti...
WP_066144411     86 YH-GKIDAFVVRYPRNGKTYW-------------------------------------------IYVNEAT---VQKMEL 118 Haladaptatus...
CQH61498         79 YD-GDVDYFLVYCHDLETMYL-------------------------------------------V-AEEAV---TSNMRL 110 Halobacteriu...
WP_017749489     81 YNpSDFDFALVYIESLDLFYV-------------------------------------------FPVEVFIs-yGSEIHF 116 Scytonema ho...
WP_045054052     81 YKqSDFEFALAYIEQLDLFYV-------------------------------------------FPVDIFIg-yGSEIHL 116 Aliterella a...
ASGPB:GKIL_1265  81 YRvSDFDFALAYIQPIDLFYV-------------------------------------------FPVHIFId-yGSEIHL 116 Gloeobacter ...
KIF32702         78 YNtKDFDFYAVYLPDIDKVVYpsinfggccintqipnsatpfywwedftdfteealkrtykefgVDLTTRKvnpDSRIHT 157 Hassallia by...
EON24873        114 SDkAEVDVLCIYCPQTDSCYY-----------------------------------------------LRPtdfRRSVTL 146 Nocardioides...
WP_036396434     82 IDkNSVDTICIYCPETDQCYY-----------------------------------------------LRPadhNASVTL 114 Mycolicibact...
WP_019512141     82 IDkGAVDVICIYCPDTDECYY-----------------------------------------------IRPsdhGVSVNL 114 Mycobacteria...
2OST_D          118 VETDKRQRKp--------RSFGYREAWHLI 139 Synechocystis sp. PCC 6803
WP_066144411    119 RFD-AKIDH---------PSINWAKEYEFT 138 Haladaptatus sp. R4
CQH61498        111 RVEDPEVEQ---------PSINWAADYEFD 131 Halobacterium hubeiense
WP_017749489    117 VETDKRQRKp--------RSAKYRDAWKLM 138 Scytonema hofmannii
WP_045054052    117 VEATKRQRKt--------RSANYRDAWGLI 138 Aliterella atlantica
ASGPB:GKIL_1265 117 VEADKRQRKp--------LSATYRDAWHLI 138 Gloeobacter kilaueensis JS1
KIF32702        158 RKVERPSKEeleklvwskPTAQIGKDFGVS 187 Hassallia byssoidea VB512170
EON24873        147 RLVPSKNGQq--------RGVLPIAAFRAF 168 Nocardioides sp. CF8
WP_036396434    115 RITPVKNGQq--------KRILNAADHREL 136 Mycolicibacterium cosmeticum
WP_019512141    115 RIAAPRNGQq--------KRILAAAAFRDL 136 Mycobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap