2JO7


Conserved Protein Domain Family
Antigen_Bd37

?
pfam11641: Antigen_Bd37 
Click on image for an interactive view with Cn3D
Glycosylphosphatidylinositol-anchored merozoite surface protein
This family of proteins represents the core region of Bd37, a surface antigen of B.divergens which is GPI-anchored at the surface of the merozoite. The structure of the protein consists of mainly alpha folds and has three sub domains.
Statistics
?
PSSM-Id: 152077
View PSSM: pfam11641
Aligned: 5 rows
Threshold Bit Score: 334.515
Threshold Setting Gi: 122092132
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JO7_A   1 VKTLD----VLRGELRGQREAFLSEIIKSDGPFTILQLVGYLRVVDTDLLLKVDSTKVDEAGKKVKAYLEKIGIRGDSVE 76 
Q8T117  82 VKTLD----VLRGELRGQREAFLSEIIKSDGPFTILQLVGYLRVVDTDLLLKVDSTKVDEAGKKVKAYLEKIGIRGDSVE 157 Babesia divergens
Q8IHK6  77 VKTLE----DIRQELKGQRETFLSEIIKSNDALTILQLVGYLRVVDTDLLLNVDSAKVDEAGKRVKAYLKSIGIMDEKVE 152 Babesia divergens
Q8IHK3  68 VKSLE----DLREELKGQRETFLSKLIESDGAFGFLQLIDFLRVIDTDLLLKVDGTKVEKAGVKVKAYLESIGIKGGSVE 143 Babesia divergens
Q0P7I6  54 VKSWErspaAIIKEVKEKRERLLSRIIARNGPLTISEIVDFLRAIDGDTLVGVDQAMVERAGAKVKVYLDFIGIKGQNVE 133 Babesia divergens
2JO7_A  77 AALDNLMIKVY-EITKGTVESSAQGTD-SEELKTLLLKFSEDLKAEQELHSEAKGGE-ALLS---SMKTQHDELLKKFAA 150
Q8T117 158 AALDNLMIKVY-EITKGTVESSAQGTD-SEELKTLLLKFSEDLKAEQELHSEAKGGE-ALLS---SMKTQHDELLKKFAA 231 Babesia divergens
Q8IHK6 153 EGLVNLMTKVV-KLTRGTVEGSTQSTD-SEELKALLLKFSEDLKAEQERHSDKEESK-DLLN---NLSVHRDEFVKKFTE 226 Babesia divergens
Q8IHK3 144 ECLDNLMTKVS-AITRGTVEGSAQSTD-SEDLKTLLLKFSEDLKAEQERHGDKDESK-ELLK---NLGVQRDELVKKFTE 217 Babesia divergens
Q0P7I6 134 ESLDTLMLMVYlHFTDAPEESKTKILNiSEELNALLKKFAAELKAKRALEDSKRGTQlDLLRkvtELRMSIIDLMEKLPA 213 Babesia divergens
2JO7_A 151 LTPTFLTSEDISGYLTVPEYGAPMNAAKWKKVEGMIHG---KLESSEVPA--NLKALVAELIELREQMMDLLYGPIGHH 224
Q8T117 232 LTPTFLTSEDISGYLTVPEYGAPMNAAKWKKVEGMIHG---KLESSEVPA--NLKALVAELIELREQMMDLLYGPIGHH 305 Babesia divergens
Q8IHK6 227 ANPSFLTTDDISAFLTVPNYGSTNDHSKWKTVERKIKD---KVESRDITT--ELKTLIGELIVQRENMMDLLYGK-GEF 299 Babesia divergens
Q8IHK3 218 MSPSFLTSEDISGFLTVPEYGFPMDAAKWKKVEKKISD---KLESSDITT--DLKTLLAKLIEQREKMMDLLYGPIGHE 291 Babesia divergens
Q0P7I6 214 RADAPFSVEDIYEFLTVPDYGVPTNSFAVKAIEKKITDylgTLETSDSATknELRSLIANVIEQREHIMDLIYGPFGNY 292 Babesia divergens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap